| Clone Name | bast75f12 |
|---|---|
| Clone Library Name | barley_pub |
>LRP1_HHV1F (P17588) Latency-related protein 1| Length = 340 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 5 PHCHCPNINPSRLIPNPNHSPSPPMRRAAEPYEH*SH 115 PH H P + P P+ HS +PP+ RA P SH Sbjct: 32 PHSHAPPL-PRTPTPSHPHSRAPPLPRAPTPTHPHSH 67
>AL_DROME (Q06453) Homeobox protein aristaless| Length = 408 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 29 NPSRLIPNPNHSPSPPMRRAAEPYE 103 +P R +P P+H PP RAA P E Sbjct: 349 SPQRQLPPPSHQAPPPPPRAATPPE 373
>CRIM1_BRARE (Q7T3Q2) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1027 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 6 PTATARTLIPLVSSPTPITLPPLQCGELPNLTSIE 110 P P+ PT IT+ P CG L N T +E Sbjct: 439 PVTVPGECCPVCEEPTYITMAPPACGSLDNCTLLE 473
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 33 PLVSSPTPITLPPLQCGELPNLT 101 P+ PT IT+ P CGEL N T Sbjct: 454 PVCEEPTIITVDPPACGELSNCT 476
>PTC1_MOUSE (Q61115) Protein patched homolog 1 (PTC1) (PTC)| Length = 1434 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +2 Query: 17 CPNINPSR---LIPNPNHSPSPPMRRAAEPYEH*SHGS 121 CP ++P+ +P P+ P P + R A P H ++GS Sbjct: 1167 CPEVSPANGLNRLPTPSPEPPPSVVRFAVPPGHTNNGS 1204
>GROU_DROME (P16371) Protein groucho (Enhancer of split m9/10 protein)| (E(spl)m9/10) Length = 719 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +2 Query: 20 PNINPSRLIPN---PNHSPSPPMRRAAEPYE 103 P +NP +++P P P P +R A+PY+ Sbjct: 325 PGVNPKQMMPQGPPPAGYPGAPYQRPADPYQ 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,449,581 Number of Sequences: 219361 Number of extensions: 209222 Number of successful extensions: 1320 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1315 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)