| Clone Name | bast75f04 |
|---|---|
| Clone Library Name | barley_pub |
>ERG24_ARATH (Q9LDR4) Delta(14)-sterol reductase (EC 1.3.1.70) (C-14 sterol| reductase) (Sterol C14-reductase) (FACKEL protein) Length = 369 Score = 53.9 bits (128), Expect = 2e-07 Identities = 27/60 (45%), Positives = 34/60 (56%) Frame = +2 Query: 275 PGKLVAGAVLPDSSRLHYRCNXXXXXXXXXXXXXXXVYMDWMTPTVVADRGLELLSTTFI 454 PGK++ G +L D S+L YRCN + ++P VVADRGLELLS TFI Sbjct: 35 PGKVIRGVLLSDGSQLRYRCNGLLALILLVAILGICAKLGIVSPLVVADRGLELLSATFI 94
>TRX2_MOUSE (O08550) Trithorax homolog 2 (WW domain-binding protein 7)| (Fragment) Length = 290 Score = 30.8 bits (68), Expect = 1.8 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +3 Query: 9 PRASPISASVSPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRR 167 P ASP+ VSPP PL P + P S + P S PL+P +R Sbjct: 63 PPASPLPPPVSPPPPLSPPPYPAPEK-QEESPPLVPATCSRKRGRPPLTPSQR 114
>RAPH1_HUMAN (Q70E73) Ras-associated and pleckstrin homology domains-containing| protein 1 (RAPH1) (Lamellipodin) (Proline-rich EVH1 ligand 2) (PREL-2) (Protein RMO1) (Amyotrophic lateral sclerosis 2 chromosomal region candidate 9 gene protein) Length = 1302 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 19 PQFPPRSRRRSLCIPPSTVDPATHRPPPDPSRRS 120 P FPP SL PP P PPP P S Sbjct: 966 PDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTAS 999
>ERG24_ASCIM (P78575) Delta(14)-sterol reductase (EC 1.3.1.70) (C-14 sterol| reductase) (Sterol C14-reductase) Length = 430 Score = 30.4 bits (67), Expect = 2.4 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 Query: 275 PGKLVAGAVLPDSSRLHYRCN 337 P ++ G VL D SRL YRCN Sbjct: 84 PAEIAEGVVLKDGSRLKYRCN 104
>HSH2D_MOUSE (Q6VYH9) Hematopoietic SH2 domain-containing protein (Hematopoietic| SH2 protein) (Adaptor in lymphocytes of unknown function X) Length = 334 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 4/29 (13%) Frame = -1 Query: 139 TSHSEASCGAT----DPEEAGALRGRRWT 65 TSHSE SC AT +P E ALRGR T Sbjct: 250 TSHSEDSCAATTSLQNPAEPQALRGREAT 278
>VP61_NPVOP (O10270) 61 kDa protein homolog| Length = 474 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 19 PQFPPRSRRRSLCIPPSTVDPATHRPPPDP 108 P FP S+ PP VD AT PPP P Sbjct: 286 PPFPSADVTTSMPPPPPMVDLATSMPPPPP 315
>NUP53_MOUSE (Q8R4R6) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) (Mitotic phosphoprotein 44) (MP-44) Length = 325 Score = 29.6 bits (65), Expect = 4.1 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +3 Query: 18 SPISASVSPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRR 167 SP+ A SPPQP+ PA H+ AP S+ ++S L PL+ RR+ Sbjct: 66 SPLLAGGSPPQPVVPA-HKDKSGAPPVR-SIYDDISSPGLGSTPLTSRRQ 113
>HERC2_DROME (Q9VR91) HECT domain and RCC1-like domain-containing protein 2| Length = 4912 Score = 29.6 bits (65), Expect = 4.1 Identities = 20/49 (40%), Positives = 23/49 (46%) Frame = +3 Query: 48 QPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRRG*WTRPTCS 194 QPL P R A A+S S APQ L W LS ++G PT S Sbjct: 509 QPLMPRCLLRGGQATAASSSSAPQQRIYALGWPSLSKDQQGFSAEPTLS 557
>NUP53_XENTR (Q66IJ0) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) Length = 330 Score = 29.6 bits (65), Expect = 4.1 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 18 SPISASVSPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRR 164 SP+ + SPPQP+ P H+ AP S+ +AS L PL+PR+ Sbjct: 58 SPLLSGGSPPQPVVP-THKDKSGAPPVR-SIYDDIASPGLGSTPLNPRK 104
>NUP53_HUMAN (Q8NFH5) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) (Mitotic phosphoprotein 44) (MP-44) Length = 326 Score = 29.6 bits (65), Expect = 4.1 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +3 Query: 18 SPISASVSPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRR 167 SP+ A SPPQP+ PA H+ AP S+ ++S L PL+ RR+ Sbjct: 66 SPLLAGGSPPQPVVPA-HKDKSGAPPVR-SIYDDISSPGLGSTPLTSRRQ 113
>RGS14_HUMAN (O43566) Regulator of G-protein signaling 14 (RGS14)| Length = 594 Score = 29.3 bits (64), Expect = 5.3 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 34 RSRRRSLCIPPSTVDPATHRPPPDPS 111 +S RS PP T D ATH PP PS Sbjct: 455 KSPCRSQGCPPRTQDKATHPPPASPS 480
>WASL_HUMAN (O00401) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 29.3 bits (64), Expect = 5.3 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 28 PPRSRRRSLCIPPSTVDPATHRPPPDPSRRS 120 PP +R R PP + P PPP PSR S Sbjct: 301 PPPARGRGAPPPPPSRAPTAAPPPPPPSRPS 331
>CONT_DROME (Q9VN14) Contactin precursor| Length = 1390 Score = 29.3 bits (64), Expect = 5.3 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 39 SPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRR 167 S P P++ +P AP + G ++ + WDPL P+ + Sbjct: 1037 SAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQ 1079
>ATX2_MOUSE (O70305) Ataxin-2 (Spinocerebellar ataxia type 2 protein homolog)| Length = 1285 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 DPRASPISASVSP-PQPLHPAVHRRPRNAPASSGSVAPQLAS 128 +P P++ S+ P PQP PA R+P SS AP A+ Sbjct: 143 EPVYGPLTMSLKPQPQPPAPATGRKPGGGLLSSPGAAPASAA 184
>NUP53_RAT (Q68FY1) Nucleoporin NUP53 (Nuclear pore complex protein Nup53)| (Nucleoporin Nup35) (35 kDa nucleoporin) Length = 325 Score = 28.9 bits (63), Expect = 6.9 Identities = 20/50 (40%), Positives = 27/50 (54%) Frame = +3 Query: 18 SPISASVSPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRR 167 SP+ A SPPQP+ PA H+ AP S+ ++S L PL RR+ Sbjct: 66 SPLLAGGSPPQPVVPA-HKDKSGAPPVR-SIYDDISSPGLGSTPLPSRRQ 113
>MILK1_HUMAN (Q8N3F8) Molecule interacting with Rab13 (MIRab13) (MICAL-like| protein 1) Length = 863 Score = 28.9 bits (63), Expect = 6.9 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 9 PRASPISASVSPPQPLHPAVHRRPRNAPASSGSVAPQLASE*LVWDPLSPRRR 167 P+ASP + P +P P + + PA + AP+ ASE P +PR R Sbjct: 270 PKASPEARPQIPTKPRVPGKLQELASPPAGRPTPAPRKASESTTPAPPTPRPR 322
>SMOO_HUMAN (P53814) Smoothelin| Length = 917 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 1 TEIHVLPQFPPRSRRRSLCIPPSTVDPATHRPPPDPSRRSWLRSD*FGIP 150 T + +L + PP S S P S+ PA+ PP +P+ L ++ G P Sbjct: 185 TTVTLLLRAPPGSTSSSPASPSSSPTPASPEPPLEPAEAQCLTAEVPGSP 234
>PP1RA_XENLA (Q6GLQ4) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 Length = 819 Score = 28.9 bits (63), Expect = 6.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 25 FPPRSRRRSLCIPPSTVDPATHRPPPDPS 111 FPP S++ PP P H PPP P+ Sbjct: 635 FPPPSQKNHQPPPPHHQPPPPHYPPPGPN 663
>LRP3_RAT (O88204) Low-density lipoprotein receptor-related protein 3| precursor (rLRp105) Length = 770 Score = 28.5 bits (62), Expect = 9.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 19 PQFPPRSRRRSLCIPPSTVDPATHRPPPDP 108 P++ P + R C+ P PA PP+P Sbjct: 691 PEYRPEDKERKACVDPLEDSPAPVDTPPEP 720
>WASL_RAT (O08816) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 28 PPRSRRRSLCIPPSTVDPATHRPPPDPSR 114 PP +R R PP + P PPP PSR Sbjct: 298 PPPARGRGAPPPPPSRAPTAAPPPPPPSR 326
>WASL_MOUSE (Q91YD9) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 501 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 28 PPRSRRRSLCIPPSTVDPATHRPPPDPSR 114 PP +R R PP + P PPP PSR Sbjct: 298 PPPARGRGAPPPPPSRAPTAAPPPPPPSR 326
>WASL_BOVIN (Q95107) Neural Wiskott-Aldrich syndrome protein (N-WASP)| Length = 505 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 28 PPRSRRRSLCIPPSTVDPATHRPPPDPSR 114 PP +R R PP + P PPP PSR Sbjct: 301 PPPARGRGAPPPPPSRAPTAAPPPPPPSR 329
>PRCC_HUMAN (Q92733) Proline-rich protein PRCC (Papillary renal cell carcinoma| translocation associated gene protein) Length = 491 Score = 28.5 bits (62), Expect = 9.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 19 PQFPPRSRRRSLCIPPSTVDPATHRPPPDP 108 P FPP L +PP T DP PPP P Sbjct: 60 PAFPP-----PLLLPPPTGDPRLQPPPPLP 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,596,669 Number of Sequences: 219361 Number of extensions: 749272 Number of successful extensions: 3742 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 3178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3700 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)