| Clone Name | bast75e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPRI_DROME (Q8MQW8) Protein sprint (SH2 poly-proline-containing ... | 29 | 5.8 | 2 | HGFL_HUMAN (P26927) Hepatocyte growth factor-like protein precur... | 28 | 9.9 | 3 | ZGPAT_MOUSE (Q8VDM1) Zinc finger CCCH-type with G patch domain p... | 28 | 9.9 | 4 | STAB2_RAT (Q8CFM6) Stabilin-2 precursor (Hyaluronan receptor for... | 28 | 9.9 |
|---|
>SPRI_DROME (Q8MQW8) Protein sprint (SH2 poly-proline-containing Ras-interactor| protein) Length = 1790 Score = 29.3 bits (64), Expect = 5.8 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 85 GLQLDQLELPSHQLPPVRT--SATAADDEDGYATPTSEAK 198 GL L L S Q+PPV S TAA+D+ G TPT+E + Sbjct: 1020 GLLLPNL---SGQVPPVAMTKSMTAAEDDGGDTTPTAEGQ 1056
>HGFL_HUMAN (P26927) Hepatocyte growth factor-like protein precursor| (Macrophage stimulatory protein) (MSP) (Macrophage-stimulating protein) [Contains: Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain] Length = 711 Score = 28.5 bits (62), Expect = 9.9 Identities = 17/58 (29%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = +1 Query: 271 QHCY------YRGRRRRCNSGPVQARYWTVAVPHDLAAVFVAQRXXXXXXXLCRPPAG 426 Q CY YRG + G VQ + W+ PH F ++ CR P G Sbjct: 368 QDCYHGAGEQYRGTVSKTRKG-VQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDG 424
>ZGPAT_MOUSE (Q8VDM1) Zinc finger CCCH-type with G patch domain protein| Length = 511 Score = 28.5 bits (62), Expect = 9.9 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 124 LPPVRTSATAADDED-GYATPTSEAKVLRAPSV 219 LPP+RT AT + D D G A+ +S A+V+ +V Sbjct: 265 LPPLRTEATESSDSDTGDASDSSYARVVEPSTV 297
>STAB2_RAT (Q8CFM6) Stabilin-2 precursor (Hyaluronan receptor for endocytosis)| [Contains: 175 kDa stabilin-2 (175 kDa hyaluronan receptor for endocytosis)] (Fragment) Length = 1431 Score = 28.5 bits (62), Expect = 9.9 Identities = 24/80 (30%), Positives = 27/80 (33%), Gaps = 9/80 (11%) Frame = -3 Query: 473 CMHGR----CQPTTCTRIFLPAGGRHSEL-EGEDGR----CATNTAARSCGTATVQ*RAC 321 C HGR CQP +C+ H + EG G C T A SC T T C Sbjct: 865 CWHGRFGPDCQPRSCSE--------HGQCDEGITGSGECLCETGWTAASCDTPTAVFAVC 916 Query: 320 TGPLLHXXXXXXX*QCCCFL 261 T C C L Sbjct: 917 TPACSVHATCTENNTCVCNL 936 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,410,695 Number of Sequences: 219361 Number of extensions: 713722 Number of successful extensions: 2325 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2324 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)