| Clone Name | bast75c09 |
|---|---|
| Clone Library Name | barley_pub |
>HIS6_MOOTA (Q2RGW2) Imidazole glycerol phosphate synthase subunit hisF (EC| 4.1.3.-) (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) Length = 252 Score = 30.4 bits (67), Expect = 1.8 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -1 Query: 249 RAPRGKDRYKWLLNVEELNKQDDLLT-VGCQK*LEDFLCQLTST 121 R P G+D W VEEL + LLT + C L+ + +LT+T Sbjct: 147 RRPTGRDAVAWARQVEELGAGEILLTSMDCDGTLDGYDLELTAT 190
>REST_HUMAN (P30622) Restin (Cytoplasmic linker protein 170 alpha-2) (CLIP-170)| (Reed-Sternberg intermediate filament-associated protein) (Cytoplasmic linker protein 1) Length = 1427 Score = 30.0 bits (66), Expect = 2.3 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -1 Query: 216 LLNVEELNKQDDLLTVGCQK*LEDFLCQLTSTK 118 L NVEELNK +LLTV QK +E+F ++ + K Sbjct: 1120 LKNVEELNKSKELLTVENQK-MEEFRKEIETLK 1151
>UPTG_PEA (O04300) Alpha-1,4-glucan-protein synthase [UDP-forming] (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase) (UPTG) (Reversibly glycosylated polypeptide) Length = 364 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = +3 Query: 324 EVDIVIAALQPNLTSFFQAWQPFFSRFDIIVV 419 E+DIVI ++ NL F + W+PFF ++ +I+V Sbjct: 14 ELDIVIPTIR-NL-DFLEMWRPFFEQYHLIIV 43
>UPTG1_SOLTU (Q9SC19) Alpha-1,4-glucan-protein synthase [UDP-forming] 1 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 1) (UPTG 1) Length = 365 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 324 EVDIVIAALQPNLTSFFQAWQPFFSRFDIIVV 419 E+DIVI ++ NL F + W+PFF + +I+V Sbjct: 11 ELDIVIPTIR-NL-DFLEMWRPFFQPYHLIIV 40
>UPTG2_SOLTU (Q8RU27) Alpha-1,4-glucan-protein synthase [UDP-forming] 2 (EC| 2.4.1.112) (UDP-glucose:protein transglucosylase 2) (UPTG 2) Length = 366 Score = 28.9 bits (63), Expect = 5.2 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 324 EVDIVIAALQPNLTSFFQAWQPFFSRFDIIVV 419 E+DIVI ++ NL F + W+PFF + +I+V Sbjct: 15 ELDIVIPTIR-NL-DFLEMWRPFFQPYHLIIV 44
>HIS6_PYRFU (P58800) Imidazole glycerol phosphate synthase subunit hisF (EC| 4.1.3.-) (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) Length = 251 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 249 RAPRGKDRYKWLLNVEELNKQDDLLT 172 R PRG D +W VEEL + LLT Sbjct: 146 RKPRGMDAVEWAKRVEELGAGEILLT 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,256,707 Number of Sequences: 219361 Number of extensions: 657292 Number of successful extensions: 2015 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2015 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)