| Clone Name | bast75c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UVRC_CHLCH (Q3AQX4) UvrABC system protein C (Protein uvrC) (Exci... | 32 | 0.64 | 2 | SWC4_ASPFU (Q4WNY4) SWR1-complex protein 4 | 30 | 2.4 | 3 | MURG_XANC5 (Q3BXF2) UDP-N-acetylglucosamine--N-acetylmuramyl-(pe... | 30 | 4.1 |
|---|
>UVRC_CHLCH (Q3AQX4) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 629 Score = 32.3 bits (72), Expect = 0.64 Identities = 23/68 (33%), Positives = 33/68 (48%) Frame = +1 Query: 253 DALGVGDKIREHHLLYERLVAFSASTGEAAAEVSLKMQGXSGPHEIRCVKRNFLLETLEN 432 DA GV KIRE LL + + + + GE+ A + L+M I V LL+ + Sbjct: 279 DACGVIFKIREGKLLGSQRIYINNTNGESEASMQLRMLEKFYVESIEPVPDEILLQEALS 338 Query: 433 ELPEGTIR 456 E E T+R Sbjct: 339 EEEEETLR 346
>SWC4_ASPFU (Q4WNY4) SWR1-complex protein 4| Length = 588 Score = 30.4 bits (67), Expect = 2.4 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -1 Query: 356 RLTSAAASPVDAEKATSLS*SRWCSLILSPTPRASSARKALVHVLNAYPDARSVADDSST 177 +LT A ++ + AT+L+ +L PT R + L+H +N DAR V++ + Sbjct: 430 KLTQAKSNVQSQKLATALAELEIPPRLLMPTERVCKEFEKLIHSVNLLLDARKVSEKIES 489 Query: 176 TLR 168 +R Sbjct: 490 EIR 492
>MURG_XANC5 (Q3BXF2) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 431 Score = 29.6 bits (65), Expect = 4.1 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = +3 Query: 270 GQDQGAPPALREAGGLLCIHRRGCRGSEPKDAGXKRSSRNSLREAQLPAGDAGER 434 G G PPA++E GL G R + G ++S N R AQL A + R Sbjct: 371 GSGDGQPPAVQERAGL------GIRNKQTHKQGSMQTSVNGDRSAQLIATNPQSR 419 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,340,209 Number of Sequences: 219361 Number of extensions: 778094 Number of successful extensions: 2301 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2301 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)