| Clone Name | bast75a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COG2_CAEEL (Q21444) Conserved oligomeric Golgi complex component... | 30 | 3.5 | 2 | MP44_MCV1 (Q98224) Probable metalloendopeptidase G1-type (EC 3.4... | 30 | 3.5 | 3 | YAR2_SCHPO (Q10135) DNA-binding protein C23E2.02 in chromosome I | 30 | 4.5 |
|---|
>COG2_CAEEL (Q21444) Conserved oligomeric Golgi complex component 2 (LDLC| protein homolog) Length = 681 Score = 30.0 bits (66), Expect = 3.5 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 62 LDCILCVKGLRSSCGQCYYLALPVTTTSSTQLQDHMSCTIV 184 L+ +LC +G+RS+ G C L L + S T+ ++ +V Sbjct: 200 LEAVLCAEGVRSAAGDCQNLPLIYSILSLTESTHSLTALLV 240
>MP44_MCV1 (Q98224) Probable metalloendopeptidase G1-type (EC 3.4.24.-)| Length = 593 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 302 EPAPSKVVNYSREFVLNLFVAHP 370 EPAP +NYS ++V+NL+V P Sbjct: 276 EPAPRVELNYSDDYVMNLYVNFP 298
>YAR2_SCHPO (Q10135) DNA-binding protein C23E2.02 in chromosome I| Length = 1273 Score = 29.6 bits (65), Expect = 4.5 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +2 Query: 71 ILCVKGLRSSCGQCYYLALPVTTTSSTQLQDHMSCTIVLESN 196 ++ ++ + G+ Y ALPV+ TS+TQ+ H S + + SN Sbjct: 546 VIILEAKERTGGRIYSRALPVSHTSATQINHHTSNSNSISSN 587 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,102,848 Number of Sequences: 219361 Number of extensions: 1072924 Number of successful extensions: 2157 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2157 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)