| Clone Name | bast75a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOIL_ELAOL (Q8S3M3) NOI-like protein | 65 | 9e-11 | 2 | RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4 | 63 | 3e-10 | 3 | IF2_XANAC (Q8PJ55) Translation initiation factor IF-2 | 30 | 4.2 | 4 | VATB_PICTO (Q6L1S8) V-type ATP synthase beta chain (EC 3.6.3.14)... | 29 | 5.5 | 5 | IF2_XANC8 (Q4UWA2) Translation initiation factor IF-2 | 29 | 7.2 | 6 | IF2_XANCP (Q8P7U7) Translation initiation factor IF-2 | 29 | 7.2 | 7 | FBX46_HUMAN (Q6PJ61) F-box only protein 46 (F-box only protein 3... | 28 | 9.4 |
|---|
>NOIL_ELAOL (Q8S3M3) NOI-like protein| Length = 228 Score = 65.1 bits (157), Expect = 9e-11 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = +1 Query: 232 AHVPKFGNWDNDGNVPYTLYFDNAR--KGKGGKPMNPNDPVENPEAFSSSVVAPSPNRS 402 AHVPKFGNWD + N+ YT YF+ KG G K NPNDP ENP+AF VA S Sbjct: 5 AHVPKFGNWDGE-NISYTTYFETVHRDKGDGSKIFNPNDPEENPQAFYPRTVAQDHQHS 62
>RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4| Length = 211 Score = 63.2 bits (152), Expect = 3e-10 Identities = 30/59 (50%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = +1 Query: 232 AHVPKFGNWDNDGNVPYTLYFDNARKGK--GGKPMNPNDPVENPEAFSSSVVAPSPNRS 402 ++VPKFGNW+ + NVPYT YFD ARK + G K MNPNDP N ++ S + P +R+ Sbjct: 4 SNVPKFGNWEAEENVPYTAYFDKARKTRAPGSKIMNPNDPEYNSDSQSQAPPHPPSSRT 62
>IF2_XANAC (Q8PJ55) Translation initiation factor IF-2| Length = 904 Score = 29.6 bits (65), Expect = 4.2 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 Query: 18 LPYRPSGARRKKQPAHISPSSRPA 89 LP PS A R +PA SP+SRPA Sbjct: 204 LPSSPSSAPRAARPAGASPASRPA 227
>VATB_PICTO (Q6L1S8) V-type ATP synthase beta chain (EC 3.6.3.14) (V-type| ATPase subunit B) Length = 460 Score = 29.3 bits (64), Expect = 5.5 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 217 KQQKNAHVPKFGNWDN 264 K+ K+AH+PK+G W+N Sbjct: 443 KKVKSAHIPKYGKWNN 458
>IF2_XANC8 (Q4UWA2) Translation initiation factor IF-2| Length = 902 Score = 28.9 bits (63), Expect = 7.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 21 PYRPSGARRKKQPAHISPSSRPAELLEP 104 P PS A R +PA SP+SRPA P Sbjct: 204 PSSPSSAPRPARPAGASPASRPATPARP 231
>IF2_XANCP (Q8P7U7) Translation initiation factor IF-2| Length = 916 Score = 28.9 bits (63), Expect = 7.2 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 21 PYRPSGARRKKQPAHISPSSRPAELLEP 104 P PS A R +PA SP+SRPA P Sbjct: 218 PSSPSSAPRPARPAGASPASRPATPARP 245
>FBX46_HUMAN (Q6PJ61) F-box only protein 46 (F-box only protein 34-like)| Length = 646 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 70 PPLPGQLSYLSHRWTNSPQED*APPPPGS 156 PP PGQL +L +R + P E PPP S Sbjct: 402 PPPPGQLFFLQNRGPDGPPE---PPPADS 427 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.135 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,208,200 Number of Sequences: 219361 Number of extensions: 808000 Number of successful extensions: 1962 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1959 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)