| Clone Name | bast74h11 |
|---|---|
| Clone Library Name | barley_pub |
>PLMN_BOVIN (P06868) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 812 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = +3 Query: 24 PEAGLRCPTAR*PRTHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQLAPKMDGAE 188 P AGL R P K W T R W+ + K+C T AP+ G E Sbjct: 424 PNAGLTMNYCRNPDADKSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVE 478
>ATS20_MOUSE (P59511) ADAMTS-20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 20) (ADAM-TS 20) (ADAM-TS20) Length = 1906 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 42 CPTAR*PRTHKGCWSIKTAGRWSWKSKSAKECVTT 146 C PRTHK C S + SWK+ KEC T Sbjct: 1452 CSHLHKPRTHKACRSGRCP---SWKANKWKECSVT 1483
>SAYP_DROME (Q9VWF2) Supporter of activation of yellow protein (Protein enhancer| of yellow 3) Length = 2006 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Frame = +3 Query: 15 RDEPEAGLRCPTAR*PRTHKGCWSI--KTAGR---WSWKSKSAKECV 140 RD PEA +RC T R R H C + + GR ++W+ K C+ Sbjct: 1707 RDMPEAFIRCYTCR-KRVHPSCVDMPPRMVGRVRNYNWQCAGCKCCI 1752
>RS13_THEVO (Q97B96) 30S ribosomal protein S13P| Length = 171 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 16 GMNRKPGYGAQLRANLEPTKGVGRLRQQD 102 G+ + GY R NL+PTK +G L++ + Sbjct: 54 GIGLRLGYAIAERLNLQPTKKIGELKEDE 82
>SYQ_CHRVO (Q7NX86) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 560 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = -2 Query: 142 VTHSLADFDFHDHRPA-------VLIDQHP 74 +THSL +F DHRP + I+ HP Sbjct: 227 ITHSLCSLEFEDHRPLYDWVLDNISIEHHP 256
>CYSH_NEIMA (Q9JUD5) Phosphoadenosine phosphosulfate reductase (EC 1.8.4.8)| (PAPS reductase, thioredoxin dependent) (PAdoPS reductase) (3'-phosphoadenylylsulfate reductase) (PAPS sulfotransferase) Length = 244 Score = 28.1 bits (61), Expect = 6.6 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 96 AGRWSWKSKSAKEC 137 AGRW W+ K++KEC Sbjct: 227 AGRWWWEDKNSKEC 240
>ZBT34_HUMAN (Q8NCN2) Zinc finger and BTB domain-containing protein 34| Length = 500 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 13 CGMNRKPGYGAQLRANLEPTKGVGRLRQQDGGHGSRNPLRSV 138 C R+P + LR P+K + R R Q+ GH R SV Sbjct: 168 CSQGRQPTASSDLRMETTPSKAL-RSRLQEEGHSDRGSSGSV 208 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,883,754 Number of Sequences: 219361 Number of extensions: 479092 Number of successful extensions: 1075 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)