| Clone Name | bast74e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMD8_YEAST (Q03697) Hypothetical 49.6 kDa protein in CAT2-AMD1 i... | 30 | 3.4 | 2 | FIBA_RAT (P06399) Fibrinogen alpha chain precursor [Contains: Fi... | 29 | 5.8 | 3 | SMS1_MOUSE (Q8VCQ6) Phosphatidylcholine:ceramide cholinephosphot... | 28 | 9.9 | 4 | SMS1_HUMAN (Q86VZ5) Phosphatidylcholine:ceramide cholinephosphot... | 28 | 9.9 |
|---|
>YMD8_YEAST (Q03697) Hypothetical 49.6 kDa protein in CAT2-AMD1 intergenic| region Length = 442 Score = 30.0 bits (66), Expect = 3.4 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 231 YVAVWIFLSFAVIVYNKYILDPK-MYNWPFPISLTMVHMS 347 +V W F S A+ +YN+++ DPK +P+ +T H + Sbjct: 9 FVFGWYFCSIALSIYNRWMFDPKDGLGIGYPVLVTTFHQA 48
>FIBA_RAT (P06399) Fibrinogen alpha chain precursor [Contains: Fibrinopeptide| A] Length = 782 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 115 GGSGSGWWRPGCVRACARGDSGLVDSGVEADLRIWGWG 2 G GSG+WRPG + + G+ G +G + D WG G Sbjct: 299 GHGGSGYWRPGSSGSGSDGNWGSGTTGSD-DTGTWGAG 335
>SMS1_MOUSE (Q8VCQ6) Phosphatidylcholine:ceramide cholinephosphotransferase 1| (EC 2.7.-.-) (Transmembrane protein 23) (Sphingomyelin synthase 1) (Mob protein) Length = 419 Score = 28.5 bits (62), Expect = 9.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 192 SESVMRKVLLSYCYVAVWIFLSFAVIVYNKYILDPKMYNWPFPISLTMVHMS 347 ++ V+++ VW + F N + P+ Y+WPFP +VH+S Sbjct: 358 NQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFP--WPVVHLS 407
>SMS1_HUMAN (Q86VZ5) Phosphatidylcholine:ceramide cholinephosphotransferase 1| (EC 2.7.-.-) (Transmembrane protein 23) (Sphingomyelin synthase 1) (Mob protein) Length = 419 Score = 28.5 bits (62), Expect = 9.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 192 SESVMRKVLLSYCYVAVWIFLSFAVIVYNKYILDPKMYNWPFPISLTMVHMS 347 ++ V+++ VW + F N + P+ Y+WPFP +VH+S Sbjct: 358 NQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFP--WPVVHLS 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,988,341 Number of Sequences: 219361 Number of extensions: 281333 Number of successful extensions: 849 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)