| Clone Name | bast74b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TSC10_NEUCR (Q7RZR2) 3-ketodihydrosphingosine reductase tsc-10 (... | 30 | 3.6 | 2 | ERG1_SCHPO (Q9C1W3) Probable squalene monooxygenase (EC 1.14.99.... | 29 | 8.1 |
|---|
>TSC10_NEUCR (Q7RZR2) 3-ketodihydrosphingosine reductase tsc-10 (EC 1.1.1.102)| (3-dehydrosphinganine reductase) (KDS reductase) Length = 969 Score = 30.0 bits (66), Expect = 3.6 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +3 Query: 168 FSYLGFQPTSVDKRESSRQYLYWGARIDCPGKHCSSCAGLGHQESSLRCALEE 326 F+++ +P V + + + W + I G+ C SCA S RC+ E Sbjct: 783 FAHIAGEPARVPCKNCHKGHGPWTSCIVVDGQMCGSCANCWFNASGARCSFHE 835
>ERG1_SCHPO (Q9C1W3) Probable squalene monooxygenase (EC 1.14.99.7) (Squalene| epoxidase) (SE) Length = 457 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 3/40 (7%) Frame = +3 Query: 306 LRCALEEALFLDRIFVMPSRMCLSSVHNTKGII---DSSN 416 LR +L+ A++ DR+ MP++ +V+ TKG+I DS+N Sbjct: 257 LRPSLKAAVYNDRLRSMPNQFLPPTVNRTKGMILVGDSNN 296 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,434,288 Number of Sequences: 219361 Number of extensions: 734056 Number of successful extensions: 1933 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1932 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)