| Clone Name | bast73g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD2L5_HUMAN (Q14004) Cell division cycle 2-like protein kinase 5... | 28 | 5.1 |
|---|
>CD2L5_HUMAN (Q14004) Cell division cycle 2-like protein kinase 5 (EC 2.7.11.22)| (CDC2-related protein kinase 5) (Cholinesterase-related cell division controller) Length = 1512 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 3 PPPPAFLWSSSDRIQASVAFGVLVSSRSFSQEPPM 107 PPPP L+ ++ A+ A SS FS PP+ Sbjct: 53 PPPPPLLFLAAPGTAAAAAAAAAASSSCFSPGPPL 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,890,954 Number of Sequences: 219361 Number of extensions: 195217 Number of successful extensions: 605 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)