| Clone Name | bast73e08 |
|---|---|
| Clone Library Name | barley_pub |
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 32.7 bits (73), Expect = 0.46 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 405 SGAGACTGSTRSPAPTKQPAPKNPKPLSTSPS 310 +G G GS+ SPAP P P +P P+ T S Sbjct: 1188 TGGGGGGGSSPSPAPAMSPVPPSPSPVPTPAS 1219
>MISS_MOUSE (Q9D7G9) MAPK-interacting and spindle-stabilizing protein| (Mitogen-activated protein kinase 1-interacting protein 1) Length = 263 Score = 32.0 bits (71), Expect = 0.79 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 369 PAPTKQPAPKNPKPLSTSPSAAN 301 P+P QP+P NP PL PSAA+ Sbjct: 137 PSPGLQPSPNNPYPLPPGPSAAS 159
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 30.4 bits (67), Expect = 2.3 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 402 GAGACTGSTRSPAPTKQPAPKNPKPLSTSPS 310 GAG GS+ SPAP P P +P P+ T S Sbjct: 1194 GAGG-GGSSPSPAPATSPVPPSPSPVPTPAS 1223
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 26.6 bits (57), Expect(2) = 2.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 375 RSPAPTKQPAPKNPKPLSTSPS 310 + P P K P PK P PL P+ Sbjct: 642 KPPEPKKPPEPKKPPPLVKQPT 663 Score = 21.9 bits (45), Expect(2) = 2.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 206 TPRSSPRLVVAESM*PPA 153 TP ++P+L VAE++ PA Sbjct: 668 TPATAPQLPVAEALPEPA 685
>SYC_WOLSU (Q7MA68) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA| ligase) (CysRS) Length = 467 Score = 29.6 bits (65), Expect = 3.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 105 ENQRCSDRCCKEEELARRWLH 167 EN+ C RC ELA+ W+H Sbjct: 241 ENEACQTRCATGRELAKYWMH 261
>CISH_HUMAN (Q9NSE2) Cytokine-inducible SH2-containing protein (CIS) (CIS-1)| (Suppressor of cytokine signaling) (SOCS) (Protein G18) Length = 258 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 393 ACTGSTRSPAPTKQPAPKNPKPLSTSPS 310 +CT TRS +P P P P P +PS Sbjct: 166 SCTADTRSDSPDPAPTPALPMPKEDAPS 193
>SSGP_VOLCA (P21997) Sulfated surface glycoprotein 185 precursor (SSG 185)| Length = 485 Score = 29.3 bits (64), Expect = 5.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 387 TGSTRSPAPTKQPAPKNPKPLSTSP 313 T S+R P+P P P +P P S SP Sbjct: 236 TASSRPPSPPPSPRPPSPPPPSPSP 260
>THAP7_HUMAN (Q9BT49) THAP domain-containing protein 7| Length = 309 Score = 28.9 bits (63), Expect = 6.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 384 GSTRSPAPTKQPAPKNPKPLSTS 316 G + P+P +QP+P P+P+S S Sbjct: 190 GCSAQPSPERQPSPLEPRPVSPS 212
>H101_CHICK (P08284) Histone H1.01| Length = 218 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 420 SRARCSGAGACTGSTRSPAPTKQPAPKNPKPLSTSPSAA 304 S + + AG + +SPA K PK KP +T P AA Sbjct: 170 SPKKAAKAGRPKKAAKSPAKAKAVKPKAAKPKATKPKAA 208
>ARMX2_MOUSE (Q6A058) Armadillo repeat-containing X-linked protein 2| Length = 784 Score = 28.9 bits (63), Expect = 6.7 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -2 Query: 420 SRARCSGAGACTGSTRSPAPTKQPAPKNPKP--LSTSPSA 307 S SGA A G T SP + P P P P +ST P+A Sbjct: 168 STTEASGAVAAPGPTVSPMIAQTPGPVVPSPTIVSTGPAA 207
>TONB_NEIGO (O06432) Protein tonB| Length = 283 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 402 GAGACTGSTRSPAPTKQPAPKNPKPL 325 G GA G+ AP QPAP PKP+ Sbjct: 52 GGGAPEGAGAPAAPEPQPAPDPPKPV 77
>CHEB2_PSE14 (Q48GG6) Chemotaxis response regulator protein-glutamate| methylesterase 2 (EC 3.1.1.61) Length = 387 Score = 28.9 bits (63), Expect = 6.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -2 Query: 429 GNLSRARCSGAGACTGSTRSPAPTKQPA---PKNPKPLSTSPSA 307 G S A + A T S+R+PAPT PA P +T+P+A Sbjct: 140 GAASAASAAAPAAPTSSSRAPAPTTAPARAVPTRTAAPATAPAA 183
>OLEOC_BRANA (P29526) Oleosin C98 (Fragment)| Length = 183 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -2 Query: 429 GNLSRARCSGAGACTGSTRSPAPTKQPAPKNPKPLSTSPSAA 304 G L++ R GAG PAP + AP + +P+AA Sbjct: 137 GLLNKLRGMGAGGAAAPAAEPAPAAEAAPAAEAAPAAAPAAA 178
>RAD52_ASHGO (Q756F4) DNA repair and recombination protein RAD52| Length = 435 Score = 28.5 bits (62), Expect = 8.7 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -2 Query: 429 GNLSRA-----RCSGAGACTGSTRSPAPTKQ--PAPKNPKPLSTSPSAAN 301 GNL RA S A T + PAP K+ P P P+P + P AA+ Sbjct: 164 GNLFRATDENNELSRANTVTDHSEGPAPKKRNAPLPPAPRPGAMRPEAAH 213
>ANCA_CLOTM (Q06848) Cellulosome-anchoring protein precursor| Length = 447 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -2 Query: 405 SGAGACTGSTRSPAPTKQPAPKNPKPLSTSP 313 SGAG TGS+ S P+ P P + ST+P Sbjct: 190 SGAGGGTGSSGSGQPSATPTPTATEKPSTTP 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,384,939 Number of Sequences: 219361 Number of extensions: 600613 Number of successful extensions: 3680 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3624 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)