| Clone Name | bast73a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLYM_RABIT (P14519) Serine hydroxymethyltransferase, mitochondri... | 28 | 5.4 |
|---|
>GLYM_RABIT (P14519) Serine hydroxymethyltransferase, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 504 Score = 28.5 bits (62), Expect = 5.4 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 19 PLTRLGLGFRRPIRAELGRAAADQGSEARGRYDGEEA 129 PL R G R +RA+ G+AA Q EA + G+E+ Sbjct: 12 PLQRCGPLVRTAVRAQHGKAAQTQTGEASRGWTGQES 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.140 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,506,557 Number of Sequences: 219361 Number of extensions: 138773 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 230 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)