| Clone Name | bast73a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HLDE_RHILO (Q98I54) Bifunctional protein hldE [Includes: D-beta-... | 30 | 2.3 | 2 | DPEP3_HUMAN (Q9H4B8) Dipeptidase 3 precursor (EC 3.4.13.19) | 29 | 3.9 | 3 | NAC_ECOLI (Q47005) Nitrogen assimilation regulatory protein nac ... | 28 | 6.6 | 4 | IE63_PRVKA (Q85232) Transcriptional regulator IE63 homolog (Prot... | 28 | 6.6 |
|---|
>HLDE_RHILO (Q98I54) Bifunctional protein hldE [Includes: D-beta-D-heptose| 7-phosphate kinase (EC 2.7.1.-) (D-beta-D-heptose 7-phosphotransferase); D-beta-D-heptose 1-phosphate adenosyltransferase (EC 2.7.7.-)] Length = 496 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 106 MAPEVKVPLLEGRGATPAQ-TLGNIVVSIV 192 ++PE +P+L GRG T A GN+V +IV Sbjct: 43 ISPEAPIPVLHGRGETSAMGGAGNVVANIV 72
>DPEP3_HUMAN (Q9H4B8) Dipeptidase 3 precursor (EC 3.4.13.19)| Length = 488 Score = 28.9 bits (63), Expect = 3.9 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 189 DGHDDVPQRLRGRRAPPLQQRHLHFRRHG--GMDGPTDRLTASQ 64 DGH+D+PQ LR R LQ +L HG +D D L +Q Sbjct: 95 DGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQ 138
>NAC_ECOLI (Q47005) Nitrogen assimilation regulatory protein nac (Nitrogen| assimilation control protein) Length = 305 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 155 GVAPLPSSSGTFTSGAMEGWMVRQT 81 GVA LP S+ GA+ GWM R T Sbjct: 234 GVAVLPESAARSLCGAVNGWMSRIT 258
>IE63_PRVKA (Q85232) Transcriptional regulator IE63 homolog (Protein UL54)| Length = 361 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = -1 Query: 168 QRLRGRRAPPLQQRHLHFRRH-----GGMDGPTDRLTASQSPCCSSRSIKLTAT 22 QR R ++ QQ+H R+ GG D P DRL+ S S+ ++ AT Sbjct: 62 QRRRQQQQQQRQQQHQRRRQEADRPDGGPDAPPDRLSESARAAVSATHARVGAT 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,513,673 Number of Sequences: 219361 Number of extensions: 395440 Number of successful extensions: 1244 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 80,573,946 effective HSP length: 41 effective length of database: 71,580,145 effective search space used: 1717923480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)