| Clone Name | bast72h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ICP0_HHV2H (P28284) Trans-acting transcriptional protein ICP0 (V... | 28 | 5.8 | 2 | PAX9_PERPO (Q2VL54) Paired box protein Pax-9 | 28 | 7.6 |
|---|
>ICP0_HHV2H (P28284) Trans-acting transcriptional protein ICP0 (VMW118 protein)| Length = 825 Score = 28.1 bits (61), Expect = 5.8 Identities = 25/99 (25%), Positives = 35/99 (35%), Gaps = 1/99 (1%) Frame = -1 Query: 296 AASLADPEMT*AMRGRDP-ATREAGGVGASLCSTKSAXXXXXXXXXXXXXXVRRTRMKRD 120 AA P+ RG P A AG S + A + Sbjct: 548 AAPRRAPDSDSGDRGHGPLAPASAGAAPPSASPSSQAAVAAASSSSASSSSASSSSASSS 607 Query: 119 SAEPTAKGSSHRRSTAAAWTTMGFIGGVGGEQAAADLAG 3 SA ++ SS S++A+ + GG GG A+A AG Sbjct: 608 SASSSSASSSSASSSSASSSA----GGAGGSVASASGAG 642
>PAX9_PERPO (Q2VL54) Paired box protein Pax-9| Length = 341 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 13 SAAACSPPTPPMKPIVVHAAAVDRRW 90 SAAA PTPP P + + A+ R W Sbjct: 167 SAAAAKVPTPPGVPAIPGSVAMPRTW 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,059,443 Number of Sequences: 219361 Number of extensions: 245672 Number of successful extensions: 1360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1356 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)