| Clone Name | bast72h03 |
|---|---|
| Clone Library Name | barley_pub |
>VIT1_FUNHE (Q90508) Vitellogenin-1 precursor (Vitellogenin I) (VTG I) [Contains:| Lipovitellin-1 (LV1); Phosvitin (PV); Lipovitellin-2 (LV2)] Length = 1704 Score = 30.0 bits (66), Expect = 1.5 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 6/96 (6%) Frame = -2 Query: 358 RFRSSNSSSKTAPVSFRWRKCRSSIS*ANSRFTT------XR*RYRASEGAEMSRSPAFF 197 R SS+SSS ++ S R RSS S ++S ++ R +S + SRS + Sbjct: 1078 RRNSSSSSSSSSSSSSESRSSRSSSSSSSSSRSSRKIDLAARTNSSSSSSSRRSRSSSSS 1137 Query: 196 ISCRSSTSQSLGLAARARWHQGLTESRAQASRCGRR 89 S SS+S S ++R R + S + +SR RR Sbjct: 1138 SSSSSSSSSSSSSSSR-RSSSSSSSSSSSSSRSSRR 1172
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 28.5 bits (62), Expect = 4.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -1 Query: 119 QGAGVALREARAHQRHHPGDGLPA 48 +GAG +EARAH R PG G A Sbjct: 1815 EGAGPTTQEARAHARTTPGGGAAA 1838
>EZY3_CHLRE (Q08356) Ezy-1 protein (Fragment)| Length = 297 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 42 AWCRETVPRVMALVSPRLPQRDACALLSVSPWCHRALAANPKL 170 AW ++ + R + VSP L AC L+++P +RALA P + Sbjct: 161 AW-QQVLGRTVPAVSPTLALVLACGYLAMAPRQYRALALVPMI 202
>IDI_AGRRH (Q9KWD1) Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) (IPP| isomerase) (Isopentenyl pyrophosphate isomerase) (IPP:DMAPP isomerase) Length = 209 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +3 Query: 120 LSVSPWCHRA------LAANPKLWEVLDLHEMKKAGERLI 221 L VSPWC L ANP W V + + KA I Sbjct: 163 LLVSPWCRAQVDLLAPLGANPSQWPVAEERRLPKAARTKI 202
>BIME_EMENI (P24686) Negative regulator of mitosis| Length = 2073 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 51 RETVPRVMALVSPRLPQRDACALLSVSPWCHRALAANPKLWEVLD 185 R +PRV +L+ P + S W H +L+ P ++VLD Sbjct: 245 RADLPRVFSLMDPH-SEMGLVVTNQASRWLHTSLSGRPSGFDVLD 288
>KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like protein RBKIN)| Length = 1805 Score = 27.3 bits (59), Expect = 9.4 Identities = 19/77 (24%), Positives = 28/77 (36%), Gaps = 11/77 (14%) Frame = +3 Query: 120 LSVSPWCHRALAANPKLWEVLDLH-----------EMKKAGERLISAPSLARYRHLXVVN 266 L++ W HR +WEV LH E+ + E IS L V Sbjct: 949 LAIEVWGHRCAGNGSSIWEVDSLHAKTRTLHDRWNEVTRRIEMWISILELNELGEYAAVE 1008 Query: 267 LEFAQDIEDRHFLHLKE 317 L A+D+ L++ Sbjct: 1009 LHQAKDVNTGGIFQLRQ 1025
>MIB2_RAT (Q68LP1) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) (RBSC-skeletrophin/dystrophin-like polypeptide) Length = 971 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 229 GAEMSRSPAFFISCRSSTSQSLGLAARAR 143 G + SPA ++CR +LG+A RAR Sbjct: 382 GQRWTFSPACLVACRPEEDANLGVAERAR 410 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,201,292 Number of Sequences: 219361 Number of extensions: 572364 Number of successful extensions: 1697 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1695 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)