| Clone Name | bast72h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WASP_MOUSE (P70315) Wiskott-Aldrich syndrome protein homolog (WASp) | 28 | 5.5 |
|---|
>WASP_MOUSE (P70315) Wiskott-Aldrich syndrome protein homolog (WASp)| Length = 520 Score = 28.5 bits (62), Expect = 5.5 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Frame = -1 Query: 85 GGRGGAPLRPQRAGA------PLLPVSAGGGWP 5 GG GG PLRP G+ PL PV GG P Sbjct: 337 GGGGGQPLRPPVVGSNKGRSGPLPPVPMGGAPP 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,097,638 Number of Sequences: 219361 Number of extensions: 164775 Number of successful extensions: 891 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 80,573,946 effective HSP length: 10 effective length of database: 78,380,336 effective search space used: 1881128064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)