| Clone Name | bast72e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRPC_ARATH (P49572) Indole-3-glycerol phosphate synthase, chloro... | 41 | 0.001 | 2 | TRPC_SYNY3 (Q55508) Indole-3-glycerol phosphate synthase (EC 4.1... | 32 | 0.45 | 3 | G6PI_VIBCH (Q9KUY4) Glucose-6-phosphate isomerase (EC 5.3.1.9) (... | 29 | 3.8 | 4 | PKD2_HUMAN (Q13563) Polycystin-2 (Autosomal dominant polycystic ... | 29 | 5.0 |
|---|
>TRPC_ARATH (P49572) Indole-3-glycerol phosphate synthase, chloroplast| precursor (EC 4.1.1.48) (IGPS) Length = 402 Score = 40.8 bits (94), Expect = 0.001 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%) Frame = +2 Query: 236 NAVELEQWESGKSANDIAACQGIRIRRHGRPAASMDDI--------QAEMGAPRNILEKI 391 N + +++WE ++A QGIRIRR A + + +PRNILE+I Sbjct: 74 NVLRIKEWEVEMYQEELAISQGIRIRRKPPSKAPLGYSGPFELRLHNNDADSPRNILEEI 133 Query: 392 IWDKEIEV 415 W K++EV Sbjct: 134 TWYKDVEV 141
>TRPC_SYNY3 (Q55508) Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS)| Length = 295 Score = 32.3 bits (72), Expect = 0.45 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +2 Query: 311 RRHGRPAASMDDIQAEM----GAPRNILEKIIWDKEIEV 415 RR P +D +Q ++ APR+ILE+I+W KE EV Sbjct: 5 RRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEV 43
>G6PI_VIBCH (Q9KUY4) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 550 Score = 29.3 bits (64), Expect = 3.8 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 209 EALARDEMLNAVELEQWESGKSANDIAACQGIRIRRHGRPAASM 340 EALA + AV+ E ++GKSA +IAA ++ RP S+ Sbjct: 430 EALAFGKSAQAVQAELEKAGKSAAEIAALVPFKVFEGNRPTNSI 473
>PKD2_HUMAN (Q13563) Polycystin-2 (Autosomal dominant polycystic kidney disease| type II protein) (Polycystwin) (R48321) Length = 968 Score = 28.9 bits (63), Expect = 5.0 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 197 RDTMEALARDEMLNAVELEQWESGKSANDIAACQGIRIRRHGRP 328 R+ ME L R+E LE+WES +A+ I+ G + +G+P Sbjct: 902 REQMERLVREE------LERWESDDAASQISHGLGTPVGLNGQP 939 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.128 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,297,571 Number of Sequences: 219361 Number of extensions: 223620 Number of successful extensions: 652 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)