| Clone Name | bast72c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APG_BRANA (P40603) Anter-specific proline-rich protein APG (Prot... | 42 | 3e-04 | 2 | APG_ARATH (P40602) Anter-specific proline-rich protein APG precu... | 37 | 0.010 | 3 | LEVR_BACSU (P23914) Transcriptional regulatory protein levR [Inc... | 27 | 9.9 |
|---|
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = +1 Query: 202 DSTVDTGNNNQIGTTLRSDFPPYGRDMPGGARATGR 309 DS DTGNNN + T L+ ++ PYG D P G ATGR Sbjct: 131 DSIFDTGNNNNLDTKLKCNYRPYGMDFPMGV-ATGR 165
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 37.4 bits (85), Expect = 0.010 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +1 Query: 202 DSTVDTGNNNQIGTTLRSDFPPYGRDMPGGARATGR 309 DS DTGNNN + T ++S++ PYG D ATGR Sbjct: 210 DSVFDTGNNNNLETKIKSNYRPYGMDFKFRV-ATGR 244
>LEVR_BACSU (P23914) Transcriptional regulatory protein levR [Includes:| Putative phosphotransferase EIIA component (EC 2.7.1.-) (Putative PTS system EIIA component)] Length = 938 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/21 (52%), Positives = 17/21 (80%), Gaps = 2/21 (9%) Frame = -2 Query: 76 WERRPAASAAER--LSVCTSG 20 WER+PAAS ++ +S+CT+G Sbjct: 701 WERQPAASGKKKALVSICTTG 721 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.133 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,515,009 Number of Sequences: 219361 Number of extensions: 327898 Number of successful extensions: 1209 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)