| Clone Name | bast72c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 p... | 78 | 4e-15 | 2 | RA51B_HUMAN (O15315) DNA repair protein RAD51 homolog 2 (R51H2) ... | 32 | 0.28 | 3 | RCOR1_HUMAN (Q9UKL0) REST corepressor 1 (Protein CoREST) | 29 | 3.1 | 4 | Y4WB_RHISN (P55680) Hypothetical zinc protease-like protein y4wB | 28 | 5.3 |
|---|
>AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 precursor| Length = 252 Score = 78.2 bits (191), Expect = 4e-15 Identities = 37/57 (64%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +1 Query: 217 YAKCEDLPQLGAALHWTYDESKSSLSLAFVAAPAGAN-GWVAWALNPTGEGMAGAQA 384 + CEDLP L + LH+TY+ S SSLS+AFVA P+ AN GWVAWA+NPTG MAG+QA Sbjct: 40 FDSCEDLPVLNSYLHYTYNSSNSSLSVAFVATPSQANGGWVAWAINPTGTKMAGSQA 96
>RA51B_HUMAN (O15315) DNA repair protein RAD51 homolog 2 (R51H2) (RAD51-like| protein 1) (Rad51B) Length = 384 Score = 32.3 bits (72), Expect = 0.28 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 6/57 (10%) Frame = -1 Query: 383 ACAPAMPSPVGLSAQATHPLAPAGAATNASERDDLDSS*VQC------SAAPSCGRS 231 ACAP M + G+ AQ + +PA +T S D+ V C + P CG++ Sbjct: 59 ACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKT 115
>RCOR1_HUMAN (Q9UKL0) REST corepressor 1 (Protein CoREST)| Length = 482 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -1 Query: 377 APAMPSPVGLSAQATHPLA-PAGAATNASERDDLDSS*VQCSAAPSCGRSSHLAYVFPAG 201 A A S SA A+ A PA A + + ++ +AAP+ G++ LA P G Sbjct: 18 AAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNG 77 Query: 200 NFS 192 N S Sbjct: 78 NSS 80
>Y4WB_RHISN (P55680) Hypothetical zinc protease-like protein y4wB| Length = 447 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 202 PAGKTYAKCED-LPQLGAALHWTYDESKSSLSLAFVAAP 315 PAG + D +P+LG A+ YD ++ LSLA+ P Sbjct: 242 PAGPSLTPVVDAVPKLGRAIRVAYDLPQAQLSLAYPGIP 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,579,158 Number of Sequences: 219361 Number of extensions: 369551 Number of successful extensions: 1685 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1678 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)