| Clone Name | bast72b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CET1_YEAST (O13297) mRNA capping enzyme beta subunit (EC 3.1.3.3... | 28 | 4.0 | 2 | CT062_HUMAN (Q4KN68) Protein C20orf62 | 28 | 5.2 |
|---|
>CET1_YEAST (O13297) mRNA capping enzyme beta subunit (EC 3.1.3.33)| (Polynucleotide 5'-triphosphatase) (mRNA 5'-triphosphatase) (TPase) Length = 549 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 303 PDDGHREA-GLGGHRPRPQLRQEANDEEDGGEDVHPG 196 P D ++E+ G G H +P+ R+ +ND+E+ D G Sbjct: 61 PIDNYKESTGHGSHSQKPKSRKSSNDDEETDTDDEMG 97
>CT062_HUMAN (Q4KN68) Protein C20orf62| Length = 170 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 377 WPGPTPSSCSSS 412 WPGPTP SC SS Sbjct: 92 WPGPTPPSCLSS 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,425,688 Number of Sequences: 219361 Number of extensions: 423818 Number of successful extensions: 1269 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)