| Clone Name | bast72b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YA28_SCHPO (Q09699) Hypothetical protein C2F7.08c in chromosome I | 29 | 6.0 | 2 | GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor (H... | 29 | 6.0 |
|---|
>YA28_SCHPO (Q09699) Hypothetical protein C2F7.08c in chromosome I| Length = 632 Score = 28.9 bits (63), Expect = 6.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = +3 Query: 297 G*DRDPTRVRRVYGAAGHGVRVPPVR-----HGTLLRGDAPPPPARFLQS 431 G DR+ R+RR G A HG+ +P +R H +L + P F+ + Sbjct: 375 GYDREARRMRRRQGRAKHGIMLPDLRDIPKIHRSLFPSSSVPSDDDFMHA 424
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 28.9 bits (63), Expect = 6.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 1 PSPAKNPNPNTDSNRSPSPIRSDAMLP 81 PSP+ +P+P+ + SPSPI S + P Sbjct: 351 PSPSPSPSPSPSPSPSPSPIPSPSPKP 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.135 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,712,732 Number of Sequences: 219361 Number of extensions: 947443 Number of successful extensions: 3447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3415 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)