| Clone Name | bast72a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RUSC2_HUMAN (Q8N2Y8) RUN and SH3 domain-containing protein 2 | 30 | 2.7 | 2 | CO8B_RABIT (P98137) Complement component C8 beta chain precursor... | 30 | 2.7 | 3 | HOX3_XENLA (P50476) Homeobox protein XHOX-3 | 29 | 4.5 | 4 | Y369_TREPA (O83384) Hypothetical protein TP0369 precursor | 29 | 4.5 | 5 | LIC4_KLULA (Q6CQB7) Protein ATC1/LIC4 | 28 | 7.7 |
|---|
>RUSC2_HUMAN (Q8N2Y8) RUN and SH3 domain-containing protein 2| Length = 1516 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 131 EPTPAGRDGVRQGAHAQGVPPLQLRAAGRG 220 +P+P V QG H+ +PP LRA G+G Sbjct: 612 DPSPPWSTQVCQGPHSSEMPPAGLRATGQG 641
>CO8B_RABIT (P98137) Complement component C8 beta chain precursor (Complement| component 8 beta subunit) Length = 590 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 186 TPCACAPCRTPSRPAGVGSRSDREGFACLVGWIGT 82 +PC CAPC+ P GSR D C VG+ G+ Sbjct: 501 SPCRCAPCQGNGVPVQKGSRCD---CICPVGFQGS 532
>HOX3_XENLA (P50476) Homeobox protein XHOX-3| Length = 388 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 213 PAARSCRGGTPCACAPCRTPSRPAGVGSRSDREGFAC 103 PA GG+PC+C C + S G+G R+ F C Sbjct: 318 PAHGLGSGGSPCSCLACLSTS-TNGLGQRAAASDFTC 353
>Y369_TREPA (O83384) Hypothetical protein TP0369 precursor| Length = 516 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 119 RSDREPTPAGRDGVRQGAHAQGV 187 + DREPT GRD V A AQGV Sbjct: 362 KKDREPTVGGRDPVPSDAVAQGV 384
>LIC4_KLULA (Q6CQB7) Protein ATC1/LIC4| Length = 283 Score = 28.5 bits (62), Expect = 7.7 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Frame = +3 Query: 105 KQIPLDP------TASQLPPAEMASGKVHTHKAFLLCNYALLGAASSC 230 KQ+PL P T +Q+ AEM ++THK L N+ G A SC Sbjct: 196 KQVPLPPKLTNEFTMTQV--AEMKKRVINTHKLILNFNFLKDGYARSC 241 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.301 0.120 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,071,712 Number of Sequences: 219361 Number of extensions: 523382 Number of successful extensions: 1527 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1526 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 17 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.7 bits)