| Clone Name | bast71g06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (U... | 31 | 1.6 | 2 | PDE8B_HUMAN (O95263) High-affinity cAMP-specific and IBMX-insens... | 29 | 5.9 | 3 | MAD1_ASHGO (Q754Z1) Spindle assembly checkpoint component MAD1 (... | 28 | 7.7 |
|---|
>KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (UHS keratin)| Length = 182 Score = 30.8 bits (68), Expect = 1.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 374 GACSHTGSYVGRCTSTRGRSYSCGARGTGCG 282 G+C + G C ++G SCG G+GCG Sbjct: 108 GSCGGSKGGCGSCGGSKGGCGSCGGCGSGCG 138
>PDE8B_HUMAN (O95263) High-affinity cAMP-specific and IBMX-insensitive| 3',5'-cyclic phosphodiesterase 8B (EC 3.1.4.17) (HSPDE8B) Length = 885 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -3 Query: 428 RRRGPEDVVHEERQRAVAGACSHTGSYVGRCTSTRGRSYSC 306 R GP V R R G+ S GS T++RGR C Sbjct: 57 RASGPPSVARVRRARTELGSGSSAGSAAPAATTSRGRRRHC 97
>MAD1_ASHGO (Q754Z1) Spindle assembly checkpoint component MAD1 (Mitotic arrest| deficient protein 1) Length = 659 Score = 28.5 bits (62), Expect = 7.7 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -3 Query: 140 AAGECAARQSK--RGHHVDVERRLGHLRACTEDSVGRAATLSDGLRA 6 AAG AA QS R + ++ER++G LRA E R ++ GL+A Sbjct: 143 AAGAAAAEQSGLLRKYEAEIERQMGELRALAERLAEREDEVA-GLKA 188 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,546,000 Number of Sequences: 219361 Number of extensions: 570475 Number of successful extensions: 2062 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2046 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)