| Clone Name | bast71f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OXR1_CRYNE (Q5KF46) Oxidation resistance protein 1 | 31 | 1.4 | 2 | MSB1_YEAST (P21339) Morphogenesis-related protein MSB1 (Multicop... | 29 | 3.9 | 3 | JHD1A_XENTR (Q5U263) JmjC domain-containing histone demethylatio... | 28 | 6.7 |
|---|
>OXR1_CRYNE (Q5KF46) Oxidation resistance protein 1| Length = 465 Score = 30.8 bits (68), Expect = 1.4 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 5 HTPRARARGSLPESPAKLKLPRDLKT--TSFSPHFPP 109 ++PR+R G LPES + PR L T +S SP PP Sbjct: 81 YSPRSRPTGVLPESVPHARSPRRLSTFSSSTSPTSPP 117
>MSB1_YEAST (P21339) Morphogenesis-related protein MSB1 (Multicopy suppressor| of bud emergence 1) Length = 1137 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 5 HTPRARARGSLPESPAKLKLPRDLKTTSFSPHFPPR 112 H A R +P+ KLPR LK+ F+ +PPR Sbjct: 274 HLLLAFLRSFVPQDLESAKLPRTLKSLLFNNQYPPR 309
>JHD1A_XENTR (Q5U263) JmjC domain-containing histone demethylation protein 1A| (EC 1.14.11.-) (F-box/LRR-repeat protein 11) (F-box and leucine-rich repeat protein 11) Length = 1146 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 12 QEQEREDHSQNHRLSLSSLVISKPPLFPPTFHLVLTDGVPP 134 ++QER+ H + R+ + +L S PL PP + T PP Sbjct: 428 RDQERDRHGRTERIIIHTLPASLRPLTPPPSLPLPTPDSPP 468 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,881,948 Number of Sequences: 219361 Number of extensions: 546880 Number of successful extensions: 1659 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1654 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)