ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast71c12 |
|---|---|
| Clone Library Name | barley_pub |
>FTSK_STRR6 (P64167) DNA translocase ftsK| Length = 767 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 77 AGFFPSGRGLWWCGHRPRRAERFI 6 A FF G WW GH R+ ERF+ Sbjct: 182 AEFFSRGFAKWWEGHERRKEERFV 205
>FTSK_STRPN (P64166) DNA translocase ftsK| Length = 767 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 77 AGFFPSGRGLWWCGHRPRRAERFI 6 A FF G WW GH R+ ERF+ Sbjct: 182 AEFFSRGFAKWWEGHERRKEERFV 205
>STK36_HUMAN (Q9NRP7) Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused| homolog) Length = 1315 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -3 Query: 198 LQAGVAARRGREGWPREAEGSDAAAARENRCAP---RAGPPHRRRVFSE 61 L AG+ A + W + G +A RENR P RA P R V + Sbjct: 353 LLAGILASELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQ 401
>STK36_PONPY (Q5RAJ5) Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused| homolog) Length = 1315 Score = 29.6 bits (65), Expect = 2.3 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = -3 Query: 198 LQAGVAARRGREGWPREAEGSDAAAARENRCAP---RAGPPHRRRVFSE 61 L AG+ A + W G +A RENR P RA P R V + Sbjct: 353 LLAGILASELKSSWAESGTGEAPSAPRENRTTPDCERAFPEERPEVLGQ 401
>PK1_STRTO (Q9KIG4) Serine/threonine-protein kinase PK-1 (EC 2.7.11.1)| (stoPK-1) Length = 641 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 131 LPPLGRTGVRQGP-----GLLIAAGFFPSGRGLWW 42 LPP GRT +R+GP G+L+ G G G+W+ Sbjct: 341 LPPRGRTALRRGPMAIVIGVLLVLGL---GAGVWY 372
>MAUF_PARVE (Q56463) Methylamine utilization protein mauF| Length = 274 Score = 29.3 bits (64), Expect = 3.0 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = -3 Query: 135 DAAAARENRCAPRAGPPHRRRVFSEWPRSLVVRSSATAGGA 13 D AA R + A P R FS W R+L++ +SA GGA Sbjct: 8 DMAAGRTDGVADCVAFPGR---FSTWTRALILAASAAGGGA 45
>PCLO_MOUSE (Q9QYX7) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) (Brain-derived HLMN protein) Length = 5038 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 64 GKNPAAMRRPGPWRTPVLPSGGSVGSLRLAGPALPSAPRRDAGLE 198 G A +++PGP ++P P+G G P P + AGLE Sbjct: 275 GPAKATVQQPGPAKSPAQPAG--TGKSPAQPPVTAKPPAQQAGLE 317
>PDCD7_MOUSE (Q9WTY1) Programmed cell death protein 7 (ES18)| Length = 482 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 85 RRPGPWRTPVLPSGGSVGSLR 147 RRPG RTP P+G S+G +R Sbjct: 154 RRPGGLRTPRTPAGPSLGEVR 174
>EPN3_MOUSE (Q91W69) Epsin-3 (EPS-15-interacting protein 3)| Length = 636 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 97 PW-RTPVLPSGGSVGSLRLAGPALPSAPRR 183 PW RTPVLPSG + A P PS+P R Sbjct: 366 PWGRTPVLPSGPPI-----ADPWAPSSPTR 390
>CJ047_HUMAN (Q86WR7) Protein C10orf47| Length = 435 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 70 NPAAMRRPGPWRTPVL--PSGGSVGSLRLAGPALPSAPR 180 +P RPG WRTP P G G + PA P APR Sbjct: 215 SPFREGRPGEWRTPAARGPRSGDPGP-GPSHPAQPKAPR 252
>IG2AS_HUMAN (Q6U949) Putative insulin-like growth factor 2 antisense gene| protein (IGF2-AS) (PEG8/IGF2AS protein) Length = 168 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 15/48 (31%) Frame = +3 Query: 6 NKPLRPPW---------------PMTAPPETAATRKKPGGDEEARPLA 104 + PLR PW P +APP A R++ G D PLA Sbjct: 106 SSPLRRPWDQAQHFTNPAPFSKGPQSAPPSPPAGRRRRGADLALAPLA 153
>GT2D1_HUMAN (Q9UHL9) General transcription factor II-I repeat domain-containing| protein 1 (GTF2I repeat domain-containing protein 1) (Muscle TFII-I repeat domain-containing protein 1) (General transcription factor III) (Slow-muscle-fiber enhancer binding Length = 959 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 103 RTPVLPSGGSVGSLRLAGPALPSAPRRDAG 192 + P++ S G+ SL + PALP P RD+G Sbjct: 648 KEPIMDSQGTASSLGFSPPALP--PERDSG 675
>COPZ2_HUMAN (Q9P299) Coatomer subunit zeta-2 (Zeta-2 coat protein) (Zeta-2 COP)| Length = 210 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 165 EGWPREAEGSDAAAARENRCAP--RAGPPHRRRV 70 E WPR G AAAA+ AP RAG P R+ Sbjct: 5 EAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRL 38
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 27.7 bits (60), Expect = 8.6 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 64 GKNPAAMRRPGPWRTPVLPSGGSVGSLRLAGPALPSA--PRRDAGLE 198 G A +++PGP ++P P+G PA P A P + AGLE Sbjct: 277 GSAKATVQQPGPAKSPAQPAGTG------KSPAQPPAKTPGQQAGLE 317
>VASP_MOUSE (P70460) Vasodilator-stimulated phosphoprotein (VASP)| Length = 374 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +1 Query: 91 PGPWRTPVLPSGGSVGSLRLAGPALPSAP 177 PGP P LPS G G+ AG A P AP Sbjct: 175 PGPPPPPGLPSSGVSGAGHGAGAAPPPAP 203 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,610,498 Number of Sequences: 219361 Number of extensions: 488047 Number of successful extensions: 1877 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1876 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)
