ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast71b01 |
|---|---|
| Clone Library Name | barley_pub |
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 107 bits (268), Expect = 7e-24 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFDPCAGV 189 KDY+DPPPAPLFD+GELR+WSFYRALIAEF+ATLLFLYITVATVIGYKVQ D C GV Sbjct: 15 KDYTDPPPAPLFDVGELRLWSFYRALIAEFIATLLFLYITVATVIGYKVQSSADQCGGV 73
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 97.4 bits (241), Expect = 9e-21 Identities = 46/59 (77%), Positives = 51/59 (86%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFDPCAGV 189 KDY DPPPAP FDMGEL++WSF+RA IAEF+ATLLFLYITVATVIGYK + DPCA V Sbjct: 17 KDYVDPPPAPFFDMGELKLWSFWRAAIAEFIATLLFLYITVATVIGYKKET--DPCASV 73
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 95.5 bits (236), Expect = 3e-20 Identities = 46/59 (77%), Positives = 50/59 (84%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFDPCAGV 189 KDY DPPPAPL DMGEL+ WSFYRALIAEF+ATLLFLY+TVATVIG+K Q PC GV Sbjct: 15 KDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLYVTVATVIGHKKQT--GPCDGV 71
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 94.0 bits (232), Expect = 1e-19 Identities = 44/59 (74%), Positives = 50/59 (84%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFDPCAGV 189 KDY DPPPAPL DM EL++WSFYRA+IAEF+ATLLFLY+TVATVIG+K Q PC GV Sbjct: 13 KDYVDPPPAPLLDMAELKLWSFYRAIIAEFIATLLFLYVTVATVIGHKNQT--GPCGGV 69
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 88.2 bits (217), Expect = 5e-18 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = +1 Query: 4 PARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 PA +DY DPPPAP FDM ELR W YRA+IAEFVATLLFLY+++ TVIGYK Q Sbjct: 13 PAARDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQ 65
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 88.2 bits (217), Expect = 5e-18 Identities = 44/63 (69%), Positives = 47/63 (74%), Gaps = 4/63 (6%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ----LFFDPC 180 KDY DPPP PLFD EL WSFYRALIAEF+ATLLFLY+T+ TVIGYK Q L D C Sbjct: 15 KDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQC 74 Query: 181 AGV 189 GV Sbjct: 75 TGV 77
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 87.0 bits (214), Expect = 1e-17 Identities = 43/63 (68%), Positives = 47/63 (74%), Gaps = 4/63 (6%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFD----PC 180 +DY DPPPAP D EL+ WSFYRA+IAEFVATLLFLYITV TVIGYK+Q D C Sbjct: 16 RDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDC 75 Query: 181 AGV 189 GV Sbjct: 76 GGV 78
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 86.7 bits (213), Expect = 2e-17 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 KDYSDPPPAPL D EL WS YRA+IAEFVATLLFLYITVATVIGYK Q Sbjct: 19 KDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGYKHQ 68
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 86.7 bits (213), Expect = 2e-17 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +1 Query: 7 ARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 A KDY+DPPPAPL D EL WS YRA+IAEF+ATLLFLYITVATVIGYK Q Sbjct: 17 AAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQ 68
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 85.9 bits (211), Expect = 3e-17 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 KDY+DPPPAPL D+ EL WS YRA+IAEF+ATLLFLYITVATVIGYK Q Sbjct: 18 KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQ 67
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 84.3 bits (207), Expect = 8e-17 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 +DY DPPPAPL D+ EL WS YRALIAEFVATLLFLY+TVATVIGYK Q Sbjct: 16 RDYIDPPPAPLVDVDELGKWSLYRALIAEFVATLLFLYVTVATVIGYKHQ 65
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 84.0 bits (206), Expect = 1e-16 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 +DY DPPPAPL D+ EL WS YRA+IAEFVATLLFLY+TVATVIGYK Q Sbjct: 13 RDYEDPPPAPLVDIDELGRWSLYRAVIAEFVATLLFLYVTVATVIGYKHQ 62
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 84.0 bits (206), Expect = 1e-16 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 +DY DPPP P FD EL WS YRA+IAEFVATLLFLYITV TVIGYK+Q Sbjct: 14 RDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQ 63
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 83.2 bits (204), Expect = 2e-16 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 +DY DPPP P FD EL WS YRA+IAEFVATLLFLY+TV TVIGYK+Q Sbjct: 14 RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGYKIQ 63
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 81.6 bits (200), Expect = 5e-16 Identities = 40/62 (64%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Frame = +1 Query: 7 ARKDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ-LFFDPCA 183 A+ Y DPPPAPL D EL WS YRALIAEF+ATL+FLY+++ATVIGYK Q D C Sbjct: 19 AKAPYWDPPPAPLLDTSELGKWSLYRALIAEFMATLIFLYVSIATVIGYKNQRATVDACT 78 Query: 184 GV 189 GV Sbjct: 79 GV 80
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 79.0 bits (193), Expect = 3e-15 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 KDY DPPP F++ EL+ WSFYRA+IAEF+ATLLFLY+TV TVIG+K Q Sbjct: 15 KDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLYVTVLTVIGFKSQ 64
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 78.6 bits (192), Expect = 4e-15 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAPLF+ GEL WSFYRA IAEF+AT LFLYITV TV+G K Sbjct: 30 KDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVK 77
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 78.2 bits (191), Expect = 6e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIG 150 KDY +PPPAPLF+ GEL+ WSFYRA IAEFVAT LFLYIT+ TV+G Sbjct: 32 KDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMG 77
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 77.8 bits (190), Expect = 7e-15 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAP F+ GEL+ WSFYRA IAEF+AT LFLY+TV TV+G K Sbjct: 30 KDYKEPPPAPFFEPGELKSWSFYRAGIAEFIATFLFLYVTVLTVMGVK 77
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 77.4 bits (189), Expect = 1e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAPLF+ GEL WSFYRA IAEF+AT LFLYIT+ TV+G K Sbjct: 30 KDYKEPPPAPLFEPGELSSWSFYRAGIAEFMATFLFLYITILTVMGLK 77
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 77.0 bits (188), Expect = 1e-14 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAP F+ GEL WSFYRA IAEF+AT LFLYITV TV+G K Sbjct: 29 KDYKEPPPAPFFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 76.6 bits (187), Expect = 2e-14 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAPLF+ GEL WSF+RA IAEF+AT LFLYITV TV+G K Sbjct: 29 KDYKEPPPAPLFEPGELASWSFWRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 75.1 bits (183), Expect = 5e-14 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAP F+ GEL WSF+RA IAEF+AT LFLYITV TV+G K Sbjct: 29 KDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 75.1 bits (183), Expect = 5e-14 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 KDY +PPPAP F+ GEL WSF+RA IAEF+AT LFLYITV TV+G K Sbjct: 29 KDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 74.7 bits (182), Expect = 6e-14 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIG 150 KDY +PPPAPLF+ EL WSFYRA IAEF+AT LFLYITV TV+G Sbjct: 32 KDYQEPPPAPLFEPSELTSWSFYRAGIAEFIATFLFLYITVLTVMG 77
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 72.0 bits (175), Expect = 4e-13 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQ 162 KDY DPPPAPL D GEL WS YRA IAEF ATLL + I+V+TVIG K Q Sbjct: 12 KDYQDPPPAPLVDTGELGKWSLYRAAIAEFTATLLLVCISVSTVIGEKRQ 61
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 13 KDYSDPPPAPLFDMGELRMWSFYRALIAEFVATLLFLYITVATVIG 150 KDY +PP AP+F++ EL WSFYRA IAEFVAT LFLYI++ TV+G Sbjct: 31 KDYREPPAAPVFEVEELTSWSFYRAGIAEFVATFLFLYISILTVMG 76
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 37.4 bits (85), Expect = 0.011 Identities = 14/33 (42%), Positives = 26/33 (78%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 E + F+RA++AEF+AT LF++I++ + +G+K Sbjct: 3 EFKKKLFWRAVVAEFLATTLFVFISIGSALGFK 35
>AQPA_RANES (P50501) Aquaporin FA-CHIP| Length = 272 Score = 35.4 bits (80), Expect = 0.042 Identities = 13/32 (40%), Positives = 25/32 (78%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGY 153 E + +F+RA+IAEF+A +LF++I++ +G+ Sbjct: 4 EFKKKAFWRAVIAEFLAMILFVFISIGAALGF 35
>AQP1_CANFA (Q9N2J4) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 35.0 bits (79), Expect = 0.054 Identities = 14/43 (32%), Positives = 29/43 (67%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFDPCAG 186 E + F+RA++AEF+A +LF++I++ + +G+ + + AG Sbjct: 3 EFKKKLFWRAVVAEFLAMILFVFISIGSALGFNYPVRNNQTAG 45
>AQP1_PONPY (Q5R819) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 35.0 bits (79), Expect = 0.054 Identities = 13/33 (39%), Positives = 25/33 (75%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 E + F+RA++AEF+A LF++I++ + +G+K Sbjct: 3 EFKKKLFWRAVVAEFLAMTLFVFISIGSALGFK 35
>AQP1_BOVIN (P47865) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) Length = 270 Score = 34.7 bits (78), Expect = 0.071 Identities = 12/32 (37%), Positives = 25/32 (78%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGY 153 E + F+RA++AEF+A +LF++I++ + +G+ Sbjct: 3 EFKKKLFWRAVVAEFLAMILFIFISIGSALGF 34
>AQP1_SHEEP (P56401) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 271 Score = 34.7 bits (78), Expect = 0.071 Identities = 12/32 (37%), Positives = 25/32 (78%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGY 153 E + F+RA++AEF+A +LF++I++ + +G+ Sbjct: 3 EFKKKLFWRAVVAEFLAMILFIFISIGSALGF 34
>AQP1_RAT (P29975) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 34.7 bits (78), Expect = 0.071 Identities = 13/36 (36%), Positives = 26/36 (72%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQL 165 E++ F+RA++AEF+A LF++I++ + +G+ L Sbjct: 3 EIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPL 38
>AQP1_MOUSE (Q02013) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Early response protein DER2) Length = 268 Score = 34.7 bits (78), Expect = 0.071 Identities = 13/36 (36%), Positives = 26/36 (72%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQL 165 E++ F+RA++AEF+A LF++I++ + +G+ L Sbjct: 3 EIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPL 38
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 34.3 bits (77), Expect = 0.093 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLYITVATVIGY 153 M ELR +F RA++AEF+ATLLF++ + + + + Sbjct: 1 MWELRSIAFSRAVLAEFLATLLFVFFGLGSALNW 34
>AQP1_PIG (Q6PQZ1) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 33.9 bits (76), Expect = 0.12 Identities = 12/33 (36%), Positives = 25/33 (75%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 E + F+RA++AEF+A LF++I++ + +G++ Sbjct: 3 EFKKKIFWRAVVAEFLAMTLFIFISIGSALGFQ 35
>AQP2_RAT (P34080) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLYITVATVI 147 M ELR +F RA++AEF+ATLLF++ + + + Sbjct: 1 MWELRSIAFSRAVLAEFLATLLFVFFGLGSAL 32
>AQP2_MOUSE (P56402) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLYITVATVI 147 M ELR +F RA++AEF+ATLLF++ + + + Sbjct: 1 MWELRSIAFSRAVLAEFLATLLFVFFGLGSAL 32
>AQP2_HUMAN (P41181) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLYITVATVIGY 153 M ELR +F RA+ AEF+ATLLF++ + + + + Sbjct: 1 MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNW 34
>TLR21_CHICK (Q9DD78) Toll-like receptor 2 type-1 precursor| Length = 793 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 +L + +R+L+ + TL+FL+I + V+GYK Sbjct: 588 QLSLMECHRSLLVSLICTLVFLFILILVVVGYK 620
>TLR22_CHICK (Q9DGB6) Toll-like receptor 2 type-2 precursor| Length = 781 Score = 33.1 bits (74), Expect = 0.21 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLYITVATVIGYK 156 +L + +R+L+ + TL+FL+I + V+GYK Sbjct: 576 QLSLMECHRSLLVSLICTLVFLFILILVVVGYK 608
>MIP_SHEEP (Q6J8I9) Lens fiber major intrinsic protein (Aquaporin-0)| Length = 263 Score = 31.6 bits (70), Expect = 0.60 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLY 126 M ELR SF+RA+ AEF ATL +++ Sbjct: 1 MWELRSASFWRAIFAEFFATLFYVF 25
>MIP_MOUSE (P51180) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 31.6 bits (70), Expect = 0.60 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLY 126 M ELR SF+RA+ AEF ATL +++ Sbjct: 1 MWELRSASFWRAIFAEFFATLFYVF 25
>MIP_HUMAN (P30301) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 31.6 bits (70), Expect = 0.60 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLY 126 M ELR SF+RA+ AEF ATL +++ Sbjct: 1 MWELRSASFWRAIFAEFFATLFYVF 25
>MIP_CAVPO (Q6RZ07) Lens fiber major intrinsic protein (Aquaporin-0)| Length = 263 Score = 31.6 bits (70), Expect = 0.60 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLY 126 M ELR SF+RA+ AEF ATL +++ Sbjct: 1 MWELRSASFWRAIFAEFFATLFYVF 25
>MIP_CHICK (P28238) Lens fiber major intrinsic protein (Aquaporin-0) (AQP0)| (MIP26) (MP26) Length = 262 Score = 30.4 bits (67), Expect = 1.3 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLYITVATVIGYKVQLFFDP 177 M ELR SF+RA++AEF+ +LL+ T++G L + P Sbjct: 1 MRELRSSSFWRAILAEFLGSLLY------TLLGLGASLRWAP 36
>MIP_RAT (P09011) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) (Fragment) Length = 261 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 58 ELRMWSFYRALIAEFVATLLFLY 126 ELR SF+RA+ AEF ATL +++ Sbjct: 1 ELRSASFWRAIFAEFFATLFYVF 23
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 82 RALIAEFVATLLFLYITVATVIGY 153 +A +AEF+ATLLF++ V + I Y Sbjct: 19 KAYVAEFIATLLFVFAGVGSAIAY 42
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 82 RALIAEFVATLLFLYITVATVIGY 153 +A +AEF+ATLLF++ V + I Y Sbjct: 19 KAYVAEFIATLLFVFAGVGSAIAY 42
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 82 RALIAEFVATLLFLYITVATVIGY 153 +A +AEF+ATLLF++ V + I Y Sbjct: 19 KAYVAEFIATLLFVFAGVGSAIAY 42
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 82 RALIAEFVATLLFLYITVATVIGY 153 +A +AEF+ATLLF++ V + I Y Sbjct: 19 KAYVAEFIATLLFVFAGVGSAIAY 42
>MIP_BOVIN (P06624) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLY 126 M ELR SF+RA+ AEF A+L +++ Sbjct: 1 MWELRSASFWRAICAEFFASLFYVF 25
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 82 RALIAEFVATLLFLYITVATVIGY 153 RA +AEF++TLLF++ V + I Y Sbjct: 19 RAYLAEFISTLLFVFAGVGSAIAY 42
>AQP2_HORSE (P79165) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F RA++AEF+ATLLF++ + + + + Sbjct: 3 AFSRAVLAEFLATLLFVFFGLGSALNW 29
>AQP2_BOVIN (P79099) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F RA++AEF+ATLLF++ + + + + Sbjct: 3 AFSRAVLAEFLATLLFVFFGLGSALNW 29
>AQP2_TALEU (O77740) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGYKVQL 165 +F RA+ AEF+ATL+F++ + + + ++ L Sbjct: 3 AFSRAVFAEFLATLIFVFFGLGSALNWQQSL 33
>MIP_RANPI (Q06019) Lens fiber major intrinsic protein (MIP26) (MP26)| Length = 263 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 52 MGELRMWSFYRALIAEFVATLLFLY 126 M E R +SF+RA+ AEF T+ +++ Sbjct: 1 MWEFRSFSFWRAVFAEFFGTMFYVF 25
>AQP2_RABIT (P79213) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F RA+ AEF+ATLLF++ + + + + Sbjct: 3 AFSRAVFAEFLATLLFVFFGLGSALNW 29
>AQP2_DASNO (P79164) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 28.5 bits (62), Expect = 5.1 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F RA++AEF+ATL+F++ + + + + Sbjct: 3 AFSRAVLAEFLATLIFVFFGLGSALSW 29
>AQP2_CANFA (P79144) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F RA+ AEF+ATLLF++ + + + + Sbjct: 3 AFSRAVFAEFLATLLFVFFGLGSALNW 29
>AQP4_MOUSE (P55088) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F++A+ AEF+ATL+F+ + V + I + Sbjct: 33 AFWKAVSAEFLATLIFVLLGVGSTINW 59
>AQP2_PROHA (P79229) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) (Fragment) Length = 109 Score = 28.1 bits (61), Expect = 6.7 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F RA+++EF+ATLLF++ + + + + Sbjct: 3 AFSRAVLSEFLATLLFVFFGLGSALNW 29
>NIP61_ARATH (Q9SAI4) Probable aquaporin NIP6.1 (NOD26-like intrinsic protein| 6.1) Length = 305 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVI 147 S YR L AEFV TL+ ++ AT I Sbjct: 77 SLYRKLGAEFVGTLILIFAGTATAI 101
>AQP5_RAT (P47864) Aquaporin-5 (AQP-5)| Length = 265 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/25 (36%), Positives = 20/25 (80%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVI 147 +F++A+ AEF+ATL+F++ + + + Sbjct: 9 AFFKAVFAEFLATLIFVFFGLGSAL 33
>AQP5_MOUSE (Q9WTY4) Aquaporin-5 (AQP-5)| Length = 265 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/25 (36%), Positives = 20/25 (80%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVI 147 +F++A+ AEF+ATL+F++ + + + Sbjct: 9 AFFKAVFAEFLATLIFVFFGLGSAL 33
>AQP6_HUMAN (Q13520) Aquaporin-6 (AQP-6) (Aquaporin-2-like) (hKID)| Length = 282 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 64 RMW-SFYRALIAEFVATLLFLYITVATVIGYKVQL 165 R+W + RAL AEF+AT L+++ V +V+ + L Sbjct: 18 RLWKAISRALFAEFLATGLYVFFGVGSVMRWPTAL 52
>AQP4_RAT (P47863) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = +1 Query: 73 SFYRALIAEFVATLLFLYITVATVIGY 153 +F++A+ AEF+A L+F+ ++V + I + Sbjct: 33 AFWKAVTAEFLAMLIFVLLSVGSTINW 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,367,898 Number of Sequences: 219361 Number of extensions: 206970 Number of successful extensions: 676 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
