| Clone Name | bast71a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precur... | 29 | 3.9 | 2 | UL14_HCMVA (P16756) Hypothetical protein UL14 precursor | 28 | 6.7 | 3 | HIS1_PROMT (Q46GM0) ATP phosphoribosyltransferase (EC 2.4.2.17) ... | 28 | 8.8 | 4 | FGF3_MOUSE (P05524) INT-2 proto-oncogene protein precursor (Fibr... | 28 | 8.8 |
|---|
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 384 DLFKYCNIANMK-KCNVLNGCFVSVKFSSSNLCFSRISEI 268 +L CNI N K +CN + C +F S ++C S + I Sbjct: 128 NLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRI 167
>UL14_HCMVA (P16756) Hypothetical protein UL14 precursor| Length = 327 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 57 GGRWRLEEGGAGRR 16 GGRWR E+GGA +R Sbjct: 110 GGRWRFEDGGAAQR 123
>HIS1_PROMT (Q46GM0) ATP phosphoribosyltransferase (EC 2.4.2.17) (ATP-PRTase)| (ATP-PRT) Length = 220 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -1 Query: 326 ALLVSNSPVPIYVSHG 279 ALLV NS VP+YVS+G Sbjct: 48 ALLVRNSDVPVYVSYG 63
>FGF3_MOUSE (P05524) INT-2 proto-oncogene protein precursor (Fibroblast growth| factor 3) (FGF-3) (HBGF-3) Length = 274 Score = 28.1 bits (61), Expect = 8.8 Identities = 27/87 (31%), Positives = 31/87 (35%), Gaps = 2/87 (2%) Frame = -3 Query: 270 ITPSPALEEPRAGPGAVXXXXXXXXXXXXXXXXXXXRCAGPTMGRPGRRLEXXXXXXXXX 91 + P+P L E RAG A + PT G PG RL Sbjct: 6 VLPAPRLRETRAGAAAAAGGRDAGMGLIWLLLLSLLEPSWPTTG-PGTRL---------- 54 Query: 90 XXRSEIARRDRGGRWRLEE--GGAGRR 16 RRD GGR + E GGA RR Sbjct: 55 -------RRDAGGRGGVYEHLGGAPRR 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,407,010 Number of Sequences: 219361 Number of extensions: 643449 Number of successful extensions: 2451 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2447 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)