| Clone Name | bast70h08 |
|---|---|
| Clone Library Name | barley_pub |
>USF2_RAT (Q63665) Upstream stimulatory factor 2 (Upstream transcription| factor 2) (Major late transcription factor 2) Length = 346 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 383 NNWSFQLCSIVHDCLFNSSDVGAHTRGEAGGGC 285 NNW QL I+ DC ++S GA G C Sbjct: 252 NNWIVQLSKIIPDCHADNSKTGASKGGILSKAC 284
>USF2_MOUSE (Q64705) Upstream stimulatory factor 2 (Upstream transcription| factor 2) (Major late transcription factor 2) Length = 346 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 383 NNWSFQLCSIVHDCLFNSSDVGAHTRGEAGGGC 285 NNW QL I+ DC ++S GA G C Sbjct: 252 NNWIVQLSKIIPDCHADNSKTGASKGGILSKAC 284
>USF2_HUMAN (Q15853) Upstream stimulatory factor 2 (Upstream transcription| factor 2) (FOS-interacting protein) (FIP) (Major late transcription factor 2) Length = 346 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 383 NNWSFQLCSIVHDCLFNSSDVGAHTRGEAGGGC 285 NNW QL I+ DC ++S GA G C Sbjct: 252 NNWIVQLSKIIPDCNADNSKTGASKGGILSKAC 284
>EAD_EBV (P03191) Early antigen protein D (EA-D)| Length = 404 Score = 28.1 bits (61), Expect = 5.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 25 QSPKPAATNNPSPPRTPRCPLW 90 Q P+ + +PSPP PR P W Sbjct: 326 QRPRHTVSPSPSPPPPPRTPTW 347
>USF1_XENBO (Q07957) Upstream stimulatory factor 1 (USF) (SPF1) (B1 factor)| Length = 307 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 383 NNWSFQLCSIVHDCLFNSSDVGAHTRGEAGGGC 285 NNW QL I+ DC S+ G G C Sbjct: 213 NNWIVQLSKIIPDCSMESTKTGQSKGGILSKAC 245
>SRC8_CHICK (Q01406) Src substrate protein p85 (p80) (Cortactin)| Length = 563 Score = 27.7 bits (60), Expect = 6.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 25 QSPKPAATNNPSPPRTPRCPLW 90 Q+P P+ T P+ P+TP P++ Sbjct: 409 QTPPPSPTTQPAEPKTPSSPVY 430
>MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like 1 precursor| (Protein methuselah-like 1) Length = 676 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 4 LALALSFQSPKPAATNNPSPPRT 72 ++LA+ SP PAA PSPP T Sbjct: 34 MSLAIEEMSPPPAAPPRPSPPPT 56
>FABG_CUPLA (P28643) 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplast| precursor (EC 1.1.1.100) (3-ketoacyl-acyl carrier protein reductase) Length = 320 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 303 SSGVRTHVAAVEQAVVHDATELEAPVVVVT 392 +SG+R VA E+ +E+PVV+VT Sbjct: 54 TSGIRAQVATAEKVSAGAGQSVESPVVIVT 83
>Y211_BRUME (P67516) UPF0247 protein BMEI0211| Length = 174 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 353 VHDCLFNSSDVGAHTRGEAGGGCPEAVGSERGRT 252 +H+ L N+ GA + G + GG + ERG+T Sbjct: 63 IHEALDNAKSGGAKSGGTSSGGAALILLDERGKT 96
>Y1840_BRUSU (P67517) UPF0247 protein BR1840| Length = 174 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 353 VHDCLFNSSDVGAHTRGEAGGGCPEAVGSERGRT 252 +H+ L N+ GA + G + GG + ERG+T Sbjct: 63 IHEALDNAKSGGAKSGGTSSGGAALILLDERGKT 96
>LPXA_NEIMB (P95379) Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine| O-acyltransferase (EC 2.3.1.129) (UDP-N-acetylglucosamine acyltransferase) Length = 258 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -3 Query: 386 NNNWSFQLCSIVHDCLFNSSDVGAHTRGEAG 294 ++NW C + HDC+ + + A+ AG Sbjct: 109 DDNWIMAYCHLAHDCVIGNHTIFANNASLAG 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.129 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,354,438 Number of Sequences: 219361 Number of extensions: 362889 Number of successful extensions: 2180 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2177 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)