| Clone Name | bast70f11 |
|---|---|
| Clone Library Name | barley_pub |
>LPHN3_BOVIN (O97827) Latrophilin-3 precursor| Length = 1580 Score = 30.8 bits (68), Expect = 0.91 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +2 Query: 20 SPLVRGGPIVVRRPSLPSPWPRVHRAPPRDLPRREL---PSSRRA 145 +P++ GG R P+L SP R P LP R L P++ RA Sbjct: 14 APIIHGGKHSERHPALASPLRHAERGPGGALPPRHLLQQPAAERA 58
>RS3A_METJA (P54059) 30S ribosomal protein S3Ae| Length = 222 Score = 29.6 bits (65), Expect = 2.0 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 11/80 (13%) Frame = -3 Query: 298 PELGAGFVRPESYAPELLRALGLGEQAEHSVAALHGHPVGLLHFLHFE--KLTGTSA--- 134 PE G F+ Y P +L LG AE S+ L G P +H ++F+ +TG A Sbjct: 32 PEFGGVFI---GYTPANDPSLVLGRVAETSLRDLTGDPTKHMHRVYFKIFGVTGNKAIAQ 88 Query: 133 ------TRQLPPRQISGRRA 92 TR+ QI RR+ Sbjct: 89 YYGHDTTREFMKSQIRRRRS 108
>IF2_CORJK (Q4JV51) Translation initiation factor IF-2| Length = 922 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 8 PLNRSPLVRGGPIVVRRPS-LPSPWPRVHRAPPRDLPRRELPSSRRAG 148 P R+P V P P+ P+P PR +A P D+PR P SR G Sbjct: 164 PGGRAPRVANNPFSSGAPAERPAPRPRGGQAGPGDMPR---PGSRPGG 208
>TAOK2_RAT (Q9JLS3) Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand| and one amino acid protein 2) Length = 1235 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -3 Query: 157 EKLTGTSATRQLPPRQISGRRA 92 ++ G SA+RQLPP ++GRR+ Sbjct: 1204 QRRLGLSASRQLPPGTVAGRRS 1225
>Y1262_AQUAE (O67301) Hypothetical lipoprotein aq_1262 precursor| Length = 564 Score = 28.1 bits (61), Expect = 5.9 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -3 Query: 286 AGFVRPESYAPELLRALGLGEQAEHSVAA---LHGHPVGLLHFLHFEKLTGTSA 134 +GF++PE + PE RA G+ +Q V A ++G V FEK G S+ Sbjct: 486 SGFIKPELFFPEPERAYGIDKQYYRIVKAQAFIYGRDV-------FEKAFGISS 532
>NFAC4_HUMAN (Q14934) Nuclear factor of activated T-cells, cytoplasmic 4| (NF-ATc4) (NFATc4) (T cell transcription factor NFAT3) (NF-AT3) Length = 902 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 Query: 5 LPLNRSPLVRGGPIVVRRPSLPSPWPRVHRAPPRDLP 115 L L P PI + RP P P P +H PPR P Sbjct: 46 LALGEPPPYGAAPIGIPRP--PPPRPGMHSPPPRPAP 80
>NETR_MOUSE (O08762) Neurotrypsin precursor (EC 3.4.21.-) (Motopsin)| (Brain-specific serine protease 3) (BSSP-3) Length = 761 Score = 28.1 bits (61), Expect = 5.9 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +2 Query: 26 LVRGGPIVVRR--PSLPSPWPRVHRAPPRDLPRRELPSSRR 142 ++ G VV R P SP R H +PPR LPSSRR Sbjct: 10 VILGALSVVARADPVSRSPLHRPHPSPPRSQHAHYLPSSRR 50
>NUDC_PSESM (Q882A9) NADH pyrophosphatase (EC 3.6.1.22)| Length = 278 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 247 LRALGLGEQAEHSVAALHGHPVGLLHFLH 161 LRAL L Q+EH + G PV LL H Sbjct: 43 LRALDLPVQSEHGIGYFDGEPVYLLVLQH 71
>PTHB_ECOLI (P56580) Glucitol/sorbitol-specific phosphotransferase enzyme IIB| component (EC 2.7.1.69) (PTS system glucitol/sorbitol-specific EIIB component) (EII-Gut) Length = 319 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 250 LLRALGLGEQAEHSVAALHGHPVGLL 173 ++ A GLG+ H +A L HP+GL+ Sbjct: 190 IIMASGLGDWIAHGLAPLASHPLGLV 215
>BUR1_YARLI (Q6C842) Serine/threonine-protein kinase BUR1 (EC 2.7.11.22) (EC| 2.7.11.23) Length = 706 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 7/37 (18%) Frame = +2 Query: 53 RRPSLPSPWPR-------VHRAPPRDLPRRELPSSRR 142 RRP P PR PPRDLP R+LP R Sbjct: 424 RRPEGPRDGPRDRDRDEYPRELPPRDLPPRDLPPRDR 460
>GUAA_THET8 (Q5SI28) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 503 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 202 LPQSARLAHPDPGPGAA 252 LP + RL HP PGPG A Sbjct: 371 LPDTLRLRHPFPGPGLA 387
>GUAA_THET2 (Q72IE5) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 503 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 202 LPQSARLAHPDPGPGAA 252 LP + RL HP PGPG A Sbjct: 371 LPDTLRLRHPFPGPGLA 387
>WRK21_ARATH (O04336) Probable WRKY transcription factor 21 (WRKY DNA-binding| protein 21) Length = 380 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = +2 Query: 200 SCHRVLGLLTQTQGPEQL---RSIALGTDEACAKFRKV 304 SCHRVL LL ++Q + + +++ T EA +F++V Sbjct: 14 SCHRVLNLLHRSQQQDHVGFEKNLVSETREAVIRFKRV 51
>IF2_DESVH (Q72ER1) Translation initiation factor IF-2| Length = 1079 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 47 VVRRPSLPSPWPRVHRAPPRDLPRRELPS 133 ++RRP P+P +V A P + P E P+ Sbjct: 142 IIRRPDEPAPVAKVVEAAPAETPAPEAPA 170
>CAC1G_RAT (O54898) Voltage-dependent T-type calcium channel alpha-1G subunit| (Voltage-gated calcium channel alpha subunit Cav3.1) Length = 2254 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 86 PGATGSEATDDGRRSAPHAPAATGLAEG 3 PG G +TD + APH A G A G Sbjct: 1861 PGVEGVNSTDSPKPGAPHTTAHIGAASG 1888
>ZN335_HUMAN (Q9H4Z2) Zinc finger protein 335| Length = 1342 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 32 RGGPIVVRRPSLPSPWPRVHRAPPRDLPRREL 127 RG + ++RP+ +P PR PR LPR E+ Sbjct: 331 RGRQLRLQRPTPSTPRPRRRPGRPRKLPRLEI 362 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,467,524 Number of Sequences: 219361 Number of extensions: 625113 Number of successful extensions: 3007 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3003 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)