| Clone Name | bast70d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RFCL_HALMA (Q5V1F7) Replication factor C large subunit (RFC larg... | 31 | 1.3 | 2 | EXAA_PSEAE (Q9Z4J7) Quinoprotein ethanol dehydrogenase precursor... | 30 | 2.9 | 3 | MAAZ4_SCHCO (P37938) Mating-type protein A-alpha Z4 | 29 | 6.6 | 4 | DNAJ_PSEPK (Q88DU3) Chaperone protein dnaJ | 28 | 8.6 |
|---|
>RFCL_HALMA (Q5V1F7) Replication factor C large subunit (RFC large subunit)| (Clamp loader large subunit) Length = 508 Score = 31.2 bits (69), Expect = 1.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 329 YTATRDGWLQRMHPNGTWERWRFVGGTGLLGIAPSADGT 445 + + D WL R+ + WR+ G G+A + DGT Sbjct: 280 FLSNADQWLGRVRETQNYSFWRYAGDNMTAGVAAARDGT 318
>EXAA_PSEAE (Q9Z4J7) Quinoprotein ethanol dehydrogenase precursor (EC 1.1.99.-)| (QEDH) Length = 623 Score = 30.0 bits (66), Expect = 2.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 308 AAAGGALYTATRDGWLQRMHPNGTWERWRFVGGTGLL 418 A AG ++T T DG+ + E W+F G+G++ Sbjct: 528 ATAGNLVFTGTGDGYFKAFDAKSGKELWKFQTGSGIV 564
>MAAZ4_SCHCO (P37938) Mating-type protein A-alpha Z4| Length = 940 Score = 28.9 bits (63), Expect = 6.6 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 450 SMVPSAEGAMPSRPVPPTNRQRSHVPLGCILCSHP 346 S PS+ G+ P+ PV P+ + + +L SHP Sbjct: 513 SPAPSSRGSTPTSPVSPSPKAKRPAQATSLLASHP 547
>DNAJ_PSEPK (Q88DU3) Chaperone protein dnaJ| Length = 375 Score = 28.5 bits (62), Expect = 8.6 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 299 YVDAAAGGALYTATRDGWLQRMHPNGTWERWRF-VGGTGLLGIAPSADGTML 451 Y DAA GG L T DG ++ P GT +F + G G+ + G +L Sbjct: 274 YTDAALGGELEVPTLDGRVKLKIPEGTQTGKQFRLRGKGVAPVRGGGAGDLL 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,268,919 Number of Sequences: 219361 Number of extensions: 509339 Number of successful extensions: 2241 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2241 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)