| Clone Name | bast70d01 |
|---|---|
| Clone Library Name | barley_pub |
>OTC_PEA (Q43814) Ornithine carbamoyltransferase, chloroplast precursor (EC| 2.1.3.3) (OTCase) (Ornithine transcarbamylase) Length = 375 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/17 (64%), Positives = 16/17 (94%) Frame = +2 Query: 362 KDFLHINDFXQDTIMKI 412 KDF+HI+DF ++TI+KI Sbjct: 73 KDFIHIDDFDKETILKI 89
>BRD4_MOUSE (Q9ESU6) Bromodomain-containing protein 4 (Mitotic| chromosome-associated protein) (MCAP) Length = 1400 Score = 28.9 bits (63), Expect = 3.0 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 3 PDLSRSHEPPHSGRRPSRRAVHLRRIPVATSLRYPLFPPSVADSH 137 P + PP +P R VHL +P + ++ P PP +H Sbjct: 980 PPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPPPPGQQPTH 1024
>VPH_BPP2 (P26700) Probable tail fiber protein (GpH)| Length = 669 Score = 25.8 bits (55), Expect(2) = 3.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 170 SPLQPSQGDASVTVGDGGWKKGIPEAG 90 +P + G ++ VGDGG K +P+AG Sbjct: 22 APGRRKVGITTMAVGDGGGKLPVPDAG 48 Score = 21.6 bits (44), Expect(2) = 3.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 40 PECGGSWLRE 11 PE GG W+RE Sbjct: 82 PEVGGFWMRE 91
>PPCK_LEIXX (Q6AGS4) Phosphoenolpyruvate carboxykinase [GTP] (EC 4.1.1.32) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 612 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 76 GFQWQPASGIPFFHPPSPTVTEASPC 153 G W PASG P HP S A+ C Sbjct: 378 GNDWTPASGRPAAHPNSRFTVSAAQC 403
>PPCKC_BOVIN (Q8HYZ4) Phosphoenolpyruvate carboxykinase, cytosolic [GTP] (EC| 4.1.1.32) (Phosphoenolpyruvate carboxylase) (PEPCK-C) Length = 622 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 76 GFQWQPASGIPFFHPPSPTVTEASPC 153 G +W P G P HP S T AS C Sbjct: 388 GKEWDPKDGEPCAHPNSRFCTPASQC 413
>SORC3_HUMAN (Q9UPU3) VPS10 domain-containing receptor SorCS3 precursor| Length = 1222 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 244 RRMDGEQLWAPGGGRGGEDEVAAG 173 RR E L GGGRGGE +V AG Sbjct: 83 RRAGPELLPQQGGGRGGEMQVEAG 106
>PPAV_CAEEL (Q09448) Putative acid phosphatase C05C10.1 (EC 3.1.3.2)| Length = 471 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 24 EPPHSGRRPSRRAVHLRRIPV-ATSLRYPLFPPSVAD 131 EP ++ + R+ +L R + A SL Y LFPPS+ D Sbjct: 58 EPKYASKEVYFRSTNLNRTIISAMSLLYGLFPPSLYD 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,127,163 Number of Sequences: 219361 Number of extensions: 581599 Number of successful extensions: 1910 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1910 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)