| Clone Name | bast70c05 |
|---|---|
| Clone Library Name | barley_pub |
>DNBI_BHV2B (P12639) Major DNA-binding protein| Length = 1186 Score = 29.3 bits (64), Expect = 4.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 139 GRLERRGGGHWFQEQSLQVASESEQSLASYLE 44 GR RGGG W + +L VA E+E + +++ Sbjct: 1102 GRALERGGGEWSLDAALDVAREAEAMVTRHVD 1133
>CDC12_SCHPO (Q10059) Cell division control protein 12| Length = 1841 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 256 VHGTLPAGPDPVSCDPPLRAAVRGTFVEP 342 V G +PA P P PPL +A G FV P Sbjct: 937 VAGVMPAFPPPPPPPPPLVSAAGGKFVSP 965
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +2 Query: 215 CAPGDAKCLACVDKCMEP------CRRDPTQCRVTLRCEPQCAA 328 CA + CV C +P C +D + C C+P C A Sbjct: 79 CASSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCA 122
>ZNFX1_MOUSE (Q8R151) NFX1-type zinc finger-containing protein 1| Length = 1909 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 212 RCAPGDAKCLACVDKCMEPCRRDPTQCRVTLRCEPQC 322 RC + L C KC EPC + C+ T C+ +C Sbjct: 1452 RCQQPCKRLLICSHKCQEPCTGECPPCQRT--CQNRC 1486
>KRA94_HUMAN (Q9BYQ2) Keratin-associated protein 9-4 (Keratin-associated protein| 9.4) (Ultrahigh sulfur keratin-associated protein 9.4) Length = 154 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 245 CVDKCMEPCRRDPTQCRVTLRCEPQC 322 CV C +PC R PT C+ T C+P C Sbjct: 43 CVSSCCQPCCR-PTCCQNTC-CQPTC 66
>VS41_GIALA (P92127) Variant-specific surface protein VSP4A1 precursor| (CRISP-90) Length = 687 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 7/43 (16%) Frame = +2 Query: 209 FRCAPGDAKCLAC-------VDKCMEPCRRDPTQCRVTLRCEP 316 F +PG+ KC++C +D C E C ++P +C+P Sbjct: 381 FLASPGEGKCISCSDTNNGGIDGCAE-CTKEPAGPLKCTKCKP 422
>KRA98_HUMAN (Q9BYQ0) Keratin-associated protein 9-8 (Keratin-associated protein| 9.8) (Ultrahigh sulfur keratin-associated protein 9.8) Length = 159 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 245 CVDKCMEPCRRDPTQCRVTLRCEPQC 322 CV C +PC R PT C+ T C+P C Sbjct: 38 CVSSCCQPCCR-PTCCQNTC-CQPIC 61
>ZNFX1_HUMAN (Q9P2E3) NFX1-type zinc finger-containing protein 1| Length = 1918 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 212 RCAPGDAKCLACVDKCMEPCRRDPTQCRVTLRCEPQC 322 RC + L C KC EPC + C+ T C+ +C Sbjct: 1460 RCQQPCKRLLICSHKCQEPCIGECPPCQRT--CQNRC 1494 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,065,155 Number of Sequences: 219361 Number of extensions: 830606 Number of successful extensions: 2483 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2479 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)