| Clone Name | bast69h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MK14C_DROME (P83100) Putative mitogen-activated protein kinase 1... | 29 | 3.4 | 2 | SYT_RHOBA (Q7UJ52) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threon... | 27 | 9.9 |
|---|
>MK14C_DROME (P83100) Putative mitogen-activated protein kinase 14C (EC| 2.7.11.24) (MAP kinase p38c) Length = 356 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Frame = -1 Query: 165 EEVRDVAHETV-----VHEAGVVHRRLLHRPQQLPIHGSDGARPLSLALS 31 +E+R + ++ + +H AGVVHR L +P + ++G+ R L LS Sbjct: 122 QEIRIILYQILRGLKYIHSAGVVHRDL--KPCNIAVNGNSEVRILDFGLS 169
>SYT_RHOBA (Q7UJ52) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 743 Score = 27.3 bits (59), Expect = 9.9 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 147 AHETVVHEAGVVHRRLLHRPQQLPIHGS-DGARPLSLALSPLTLVDLG 7 A + V+H + H R L +P P H GA+P S PL L + G Sbjct: 394 AKKDVLHRWQLNHERYLLKPMNCPHHCQIFGAQPRSYRQLPLRLFEFG 441 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,003,796 Number of Sequences: 219361 Number of extensions: 319647 Number of successful extensions: 1051 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)