ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast69g01 |
|---|---|
| Clone Library Name | barley_pub |
>DOF57_ARATH (Q9LSL6) Dof zinc finger protein DOF5.7 (AtDOF5.7)| Length = 316 Score = 84.3 bits (207), Expect = 7e-17 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAKP 139 Y+NNYSLSQPRHFC++CRRYWTRGGA RNVP+GGG R+ K KP Sbjct: 55 YYNNYSLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKSIKP 99
>DOF36_ARATH (Q9M2U1) Dof zinc finger protein DOF3.6 (AtDOF3.6) (OBF-binding| protein 3) Length = 323 Score = 83.6 bits (205), Expect = 1e-16 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 YFNNYSL+QPRHFC+ CRRYWTRGG+ RNVPVGGG+RR+ KR+K Sbjct: 90 YFNNYSLTQPRHFCKTCRRYWTRGGSLRNVPVGGGFRRN-KRSK 132
>DOF22_ARATH (Q9ZV33) Dof zinc finger protein DOF2.2 (AtDOF2.2)| Length = 340 Score = 83.2 bits (204), Expect = 2e-16 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 YFNNY+L+QPRHFC+ACRRYWTRGGA RNVPVGGG RR+ K Sbjct: 108 YFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKK 148
>DOF14_ARATH (Q9FZA4) Hypothetical Dof zinc finger protein DOF1.4 (AtDOF1.4)| Length = 311 Score = 82.4 bits (202), Expect = 3e-16 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAKP 139 Y+NNYSLSQPRHFC+AC+RYWTRGG RNVPVGG YR++ + +P Sbjct: 41 YYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVKRP 85
>DOF51_ARATH (Q9LZ56) Dof zinc finger protein DOF5.1 (AtDOF5.1)| Length = 399 Score = 82.0 bits (201), Expect = 4e-16 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 YFNNYSL+QPRHFC+ACRRYWTRGGA R+VPVGGG RR+ KR K Sbjct: 109 YFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRN-KRTK 151
>DOF24_ARATH (O80928) Dof zinc finger protein DOF2.4 (AtDOF2.4)| Length = 330 Score = 81.6 bits (200), Expect = 5e-16 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 YFNNYSL+QPRHFC+ CRRYWTRGGA RNVPVGGG RR+ + Sbjct: 103 YFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRR 143
>DOF11_ARATH (Q8L9V6) Dof zinc finger protein DOF1.1 (AtDOF1.1) (OBF-binding| protein 2) Length = 331 Score = 81.3 bits (199), Expect = 6e-16 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 Y+NNY+L+QPRHFC+ CRRYWT+GGA RNVPVGGG RR+ K+ K Sbjct: 91 YYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRRNNKKGK 134
>DOF31_ARATH (Q94AR6) Dof zinc finger protein DOF3.1 (AtDOF3.1)| Length = 204 Score = 80.1 bits (196), Expect = 1e-15 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKR 130 Y+NNY+LSQPRHFC++CRRYWT+GGA RNVPVGGG R++A + Sbjct: 43 YYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNATK 84
>DOF17_ARATH (O82155) Dof zinc finger protein DOF1.7 (AtDOF1.7)| Length = 194 Score = 79.3 bits (194), Expect = 2e-15 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRA 133 Y+NNY+LSQPRHFC+ CRRYWT+GGA RN+PVGGG R+ KR+ Sbjct: 47 YYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKSNKRS 89
>DOF34_ARATH (Q39088) Dof zinc finger protein DOF3.4 (AtDOF3.4) (OBF-binding| protein 1) Length = 253 Score = 79.3 bits (194), Expect = 2e-15 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 Y+NNY+ SQPRHFC+ACRRYWT GG R+VPVGGG R+ AKR++ Sbjct: 44 YYNNYNFSQPRHFCKACRRYWTHGGTLRDVPVGGGTRKSAKRSR 87
>DOF32_ARATH (Q9M1E6) Dof zinc finger protein DOF3.2 (AtDOF3.2)| Length = 245 Score = 78.6 bits (192), Expect = 4e-15 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSLSQPR+FC++CRRYWT+GG RN+P+GG YR+H + Sbjct: 54 YYNNYSLSQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKR 94
>DOF54_ARATH (Q8LDR0) Dof zinc finger protein DOF5.4 (AtDOF5.4) (OBF-binding| protein 4) Length = 307 Score = 78.2 bits (191), Expect = 5e-15 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 Y+NNY+LSQPRHFC+ CRRYWT+GG RNVPVGGG R+ AKR+K Sbjct: 65 YYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK-AKRSK 107
>DOF21_ARATH (Q8LE43) Dof zinc finger protein DOF2.1 (AtDOF2.1)| Length = 288 Score = 77.0 bits (188), Expect = 1e-14 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSLSQPR+FC++CRRYWT+GG RNVPVGGG RR+ + Sbjct: 62 YYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKR 102
>DOF56_ARATH (Q9FM03) Dof zinc finger protein DOF5.6 (AtDOF5.6)| Length = 372 Score = 76.3 bits (186), Expect = 2e-14 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSLSQPR+FC+ CRRYWT+GG RN+PVGGG R++ K Sbjct: 87 YYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKK 127
>PBF_MAIZE (O24463) Dof zinc finger protein PBF (Prolamin box-binding factor)| Length = 328 Score = 75.9 bits (185), Expect = 3e-14 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYR--RHAKR 130 Y+NNYS+SQPR+FC+ACRRYWT GG RNVP+GGG R +HA R Sbjct: 74 YYNNYSMSQPRYFCKACRRYWTHGGTLRNVPIGGGCRKNKHASR 117
>DOF12_ARATH (P68349) Hypothetical Dof zinc finger protein DOF1.2 (AtDOF1.2)| Length = 260 Score = 75.9 bits (185), Expect = 3e-14 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSLSQPR+FC+ CRRYWT+GG+ RN+PVGGG R+ ++ Sbjct: 52 YYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSR 92
>DOF47_ARATH (Q84K52) Dof zinc finger protein DOF4.7 (AtDOF4.7)| Length = 246 Score = 75.1 bits (183), Expect = 4e-14 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSLSQPRH+C+ CRRYWTRGGA RNVP+GG R K Sbjct: 55 YYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIGGSTRNKNK 95
>DOF53_ARATH (Q84TE9) Dof zinc finger protein DOF5.3 (AtDOF5.3)| Length = 257 Score = 74.3 bits (181), Expect = 7e-14 Identities = 27/41 (65%), Positives = 37/41 (90%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSL+QPR+FC++CRRYWT+GG RN+PVGGG R++ + Sbjct: 69 YYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKR 109
>MNB1A_MAIZE (P38564) Dof zinc finger protein MNB1A| Length = 238 Score = 73.9 bits (180), Expect = 1e-13 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRR 118 Y+NNY+ SQPRHFC+ CRRYWT+GG RNVPVGGG R+ Sbjct: 61 YYNNYNTSQPRHFCKGCRRYWTKGGTLRNVPVGGGTRK 98
>DOF37_ARATH (Q43385) Dof zinc finger protein DOF3.7 (AtDOF3.7) (Dof affecting| germination 1) (Transcription factor BBFa) (AtBBFa) (RolB domain B factor a) Length = 296 Score = 73.9 bits (180), Expect = 1e-13 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAKP 139 Y+NNYSL+QPR+FC+ CRRYWT GG+ RNVPVGG R++ + + P Sbjct: 88 YYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTP 132
>DOF35_ARATH (Q9SVC5) Hypothetical Dof zinc finger protein DOF3.5 (AtDOF3.5)| Length = 247 Score = 73.9 bits (180), Expect = 1e-13 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRR 118 Y+NNYSL+QPR+FC+ CRRYWT+GG+ RNVPVGGG R+ Sbjct: 39 YYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRK 76
>DOF41_ARATH (Q9M161) Dof zinc finger protein DOF4.1 (AtDOF4.1)| Length = 294 Score = 73.6 bits (179), Expect = 1e-13 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAKP 139 Y+NNYSL+QPR+ C++CRRYWT GG+ RNVPVGGG R++ K P Sbjct: 82 YYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKKLPFP 126
>DOF46_ARATH (Q8LAP8) Dof zinc finger protein DOF4.6 (AtDOF4.6)| Length = 342 Score = 73.6 bits (179), Expect = 1e-13 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSL+QPR+FC+ CRRYWT GG+ RN+PVGGG R++ + Sbjct: 67 YYNNYSLTQPRYFCKGCRRYWTEGGSLRNIPVGGGSRKNKR 107
>DOF58_ARATH (Q9FGD6) Hypothetical Dof zinc finger protein DOF5.8 (AtDOF5.8)| Length = 225 Score = 73.2 bits (178), Expect = 2e-13 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 Y+NNY+ SQPRHFC++CRRYWT GG R++PVGG R+ +KR++ Sbjct: 46 YYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKSSKRSR 89
>DOF18_ARATH (Q84JQ8) Dof zinc finger protein DOF1.8 (AtDOF1.8)| Length = 352 Score = 72.8 bits (177), Expect = 2e-13 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSL+QPR+FC+ CRRYWT GG+ RN+PVGGG R++ + Sbjct: 63 YYNNYSLTQPRYFCKDCRRYWTAGGSLRNIPVGGGVRKNKR 103
>DOF25_ARATH (Q9ZPY0) Dof zinc finger protein DOF2.5 (AtDOF2.5) (Dof affecting| germination 2) Length = 369 Score = 71.6 bits (174), Expect = 5e-13 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAK 127 Y+NNYSL+QPR+FC+ CRRYWT GG+ RNVPVGG R++ + Sbjct: 94 YYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKR 134
>DOF16_ARATH (Q9SX97) Hypothetical Dof zinc finger protein DOF1.6 (AtDOF1.6)| Length = 209 Score = 71.2 bits (173), Expect = 6e-13 Identities = 26/42 (61%), Positives = 37/42 (88%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKR 130 Y+NNY+L+QPR++C++CRRYWT+GG R+VPVGGG RR + + Sbjct: 43 YYNNYNLAQPRYYCKSCRRYWTQGGTLRDVPVGGGTRRSSSK 84
>DOF15_ARATH (P68350) Dof zinc finger protein DOF1.5 (AtDOF1.5)| Length = 175 Score = 71.2 bits (173), Expect = 6e-13 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRR 118 YFNNY+++QPRHFC+ C+RYWT GGA RNVPVG G R+ Sbjct: 76 YFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRK 113
>DOF33_ARATH (Q8LFV3) Dof zinc finger protein DOF3.3 (AtDOF3.3) (H-protein| promoter-binding factor 2a) Length = 448 Score = 70.9 bits (172), Expect = 8e-13 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRH 121 Y+NNY+++QPRHFC+AC+RYWT GG RNVPVG G R++ Sbjct: 124 YYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKN 162
>DOF23_ARATH (O22967) Dof zinc finger protein DOF2.3 (AtDOF2.3)| Length = 170 Score = 70.9 bits (172), Expect = 8e-13 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRR 118 YFNNY+++QPRHFC+ C RYWT GGA RNVPVG G R+ Sbjct: 72 YFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRK 109
>DOF52_ARATH (Q93ZL5) Dof zinc finger protein DOF5.2 (AtDOF5.2)| Length = 457 Score = 68.9 bits (167), Expect = 3e-12 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRA 133 Y+NNY+++QPRHFC+ C+RYWT GG RNVPVG G R++ A Sbjct: 152 YYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSPA 194
>DOF44_ARATH (Q9SUA9) Hypothetical Dof zinc finger protein DOF4.4 (AtDOF4.4)| Length = 210 Score = 68.2 bits (165), Expect = 5e-12 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 ++NNYS SQPR+FC+ CRRYWT GGA RN+PVGG R+ KR K Sbjct: 38 FYNNYSESQPRYFCKNCRRYWTHGGALRNIPVGGSCRK-PKRLK 80
>DOF55_ARATH (Q8W1E3) Dof zinc finger protein DOF5.5 (AtDOF5.5)| Length = 298 Score = 68.2 bits (165), Expect = 5e-12 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRH 121 Y+NNY+++QPRHFC+AC+RYWT GG R+VP+G G R++ Sbjct: 68 YYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKN 106
>DOF1A_ARATH (Q9SEZ3) Dof zinc finger protein DOF1.10 (AtDOF1.10) (H-protein| promoter-binding factor 2b) Length = 399 Score = 67.4 bits (163), Expect = 9e-12 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRH 121 Y+NNY+++QPR+FCR C+RYWT GG+ RNVPVG G R++ Sbjct: 146 YYNNYNVNQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKN 184
>DOF43_ARATH (Q9SUB0) Hypothetical Dof zinc finger protein DOF4.3 (AtDOF4.3)| Length = 232 Score = 67.4 bits (163), Expect = 9e-12 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 Y+NNYS QPR+FC+ CRRYWT GGA RNVP+GG R AKR + Sbjct: 39 YYNNYSEFQPRYFCKNCRRYWTHGGALRNVPIGGSSR--AKRTR 80
>DOF13_ARATH (Q9LQX4) Hypothetical Dof zinc finger protein DOF1.3 (AtDOF1.3)| Length = 366 Score = 66.6 bits (161), Expect = 2e-11 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRH 121 Y+NNY+++QPRHFCR C+RYWT GG+ R VPVG G R++ Sbjct: 119 YYNNYNVNQPRHFCRKCQRYWTAGGSMRIVPVGSGRRKN 157
>DOF45_ARATH (O49550) Hypothetical Dof zinc finger protein DOF4.5 (AtDOF4.5)| Length = 249 Score = 66.6 bits (161), Expect = 2e-11 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGGGYRRHAKRAK 136 Y+NNY QPR+FC+ CRRYWT GGA RN+P+GG R AKRA+ Sbjct: 39 YYNNYCEFQPRYFCKNCRRYWTHGGALRNIPIGGSSR--AKRAR 80
>DOF42_ARATH (Q9SUB1) Hypothetical Dof zinc finger protein DOF4.2 (AtDOF4.2)| Length = 194 Score = 50.8 bits (120), Expect = 9e-07 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +2 Query: 2 SYFNNYSLSQPRHFCRACRRYWTRGGAFRNVPVGG 106 SYFNN SQPR+ C+ C R WT GG RN+PV G Sbjct: 34 SYFNNNKKSQPRYKCKNCCRCWTHGGVLRNIPVTG 68
>HNRL1_MOUSE (Q8VDM6) Heterogeneous nuclear ribonucleoprotein U-like protein 1| Length = 859 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 56 RRYWTRGGAFRNVPVGGGYRRHAKRAKP 139 +R+ +RGG FR GGG++R+ R P Sbjct: 608 KRFDSRGGGFRGRGGGGGFQRYDNRGPP 635
>MUTA_STRCM (Q05064) Methylmalonyl-CoA mutase small subunit (EC 5.4.99.2)| (MCM-beta) Length = 616 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 47 RACRRYWTRGGAFRNVPVGGGYRRHA 124 RA RR W R VP G R+HA Sbjct: 284 RAARRLWARVAEVSGVPAAGAQRQHA 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,362,174 Number of Sequences: 219361 Number of extensions: 214056 Number of successful extensions: 632 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
