| Clone Name | bast69f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GDIR_ARATH (Q9SFC6) Rho GDP-dissociation inhibitor 1 (Rho GDI-1)... | 54 | 2e-07 | 2 | GDIR_MOUSE (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1)... | 32 | 0.89 | 3 | GDIR_HUMAN (P52565) Rho GDP-dissociation inhibitor 1 (Rho GDI 1)... | 32 | 0.89 | 4 | GDIR_BOVIN (P19803) Rho GDP-dissociation inhibitor 1 (Rho GDI 1)... | 32 | 0.89 | 5 | H14_RABIT (P02252) Histone H1.4 (Fragment) | 29 | 5.8 |
|---|
>GDIR_ARATH (Q9SFC6) Rho GDP-dissociation inhibitor 1 (Rho GDI-1) (AtRhoGDI1)| Length = 240 Score = 53.9 bits (128), Expect = 2e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +3 Query: 336 IDLGPILSIKDQLEKDKDDECLRRWKEQXLGSVD 437 + LGP +IK+ LEKDKDDE LR+WKEQ LGSVD Sbjct: 62 LQLGPQYTIKEHLEKDKDDESLRKWKEQLLGSVD 95
>GDIR_MOUSE (Q99PT1) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI| alpha) (GDI-1) Length = 204 Score = 31.6 bits (70), Expect = 0.89 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 357 SIKDQLEKDKDDECLRRWKEQXLGSV 434 SI++ E DKDDE LR++KE LG V Sbjct: 34 SIQEIQELDKDDESLRKYKEALLGRV 59
>GDIR_HUMAN (P52565) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI| alpha) Length = 204 Score = 31.6 bits (70), Expect = 0.89 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 357 SIKDQLEKDKDDECLRRWKEQXLGSV 434 SI++ E DKDDE LR++KE LG V Sbjct: 34 SIQEIQELDKDDESLRKYKEALLGRV 59
>GDIR_BOVIN (P19803) Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI| alpha) Length = 204 Score = 31.6 bits (70), Expect = 0.89 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 357 SIKDQLEKDKDDECLRRWKEQXLGSV 434 SI++ E DKDDE LR++KE LG V Sbjct: 34 SIQEIQELDKDDESLRKYKEALLGRV 59
>H14_RABIT (P02252) Histone H1.4 (Fragment)| Length = 73 Score = 28.9 bits (63), Expect = 5.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 128 SQLTHTTAMAAPSSTPQRLAKKRRGQKEGGVAKRR 24 S+ TA AP+ +P KK R +K G AKR+ Sbjct: 1 SEAPAETAAPAPAKSPATPVKKARKKKSAGAAKRK 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,192,572 Number of Sequences: 219361 Number of extensions: 323534 Number of successful extensions: 1083 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)