| Clone Name | bast69f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AFR_ARATH (Q8LAW2) Protein AFR (Protein ATTENUATED FAR-RED RESPO... | 31 | 0.93 | 2 | DACT1_HUMAN (Q9NYF0) Dapper homolog 1 (hDPR1) (Heptacellular car... | 31 | 0.93 | 3 | GCH11_PSEPK (Q88LV4) GTP cyclohydrolase I 1 (EC 3.5.4.16) (GTP-C... | 28 | 7.9 | 4 | DACT1_MOUSE (Q8R4A3) Dapper homolog 1 (MDpr1) (Frodo) (Thymus-ex... | 28 | 7.9 |
|---|
>AFR_ARATH (Q8LAW2) Protein AFR (Protein ATTENUATED FAR-RED RESPONSE)| Length = 372 Score = 30.8 bits (68), Expect = 0.93 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 99 LIPGMPDDVAVDCLARVPHGSYRSMRRVCRGW 194 LI G+P+D+A CL R+P+ + R V W Sbjct: 28 LISGLPNDIAELCLLRLPYPYHALYRSVSSSW 59
>DACT1_HUMAN (Q9NYF0) Dapper homolog 1 (hDPR1) (Heptacellular carcinoma novel| gene 3 protein) Length = 836 Score = 30.8 bits (68), Expect = 0.93 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 160 DPCGTRARQSTATSSGIPGMRSTWSASHP 74 D CG + T S +P S WSASHP Sbjct: 304 DICGGSELDAVKTDSSLPSPSSLWSASHP 332
>GCH11_PSEPK (Q88LV4) GTP cyclohydrolase I 1 (EC 3.5.4.16) (GTP-CH-I 1)| Length = 190 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = +3 Query: 57 PKSRVQGWEADHVDLIPGMPDDVAVDCLARVPHGSYRSMRRVCRGW 194 P R E ++ +++ + +DV+ + L P + ++M+ +CRG+ Sbjct: 5 PTGRSMSLEQNYTEILSQIGEDVSREGLLDTPKRAAKAMKYLCRGY 50
>DACT1_MOUSE (Q8R4A3) Dapper homolog 1 (MDpr1) (Frodo) (Thymus-expressed novel| gene 3 protein) Length = 778 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 160 DPCGTRARQSTATSSGIPGMRSTWSASHP 74 D C +T T + +P S WSASHP Sbjct: 260 DICIGSELNATKTDNSLPSPSSLWSASHP 288 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,197,635 Number of Sequences: 219361 Number of extensions: 285118 Number of successful extensions: 1158 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)