| Clone Name | bast69e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | S3TC2_MOUSE (Q80VA5) SH3 domain and tetratricopeptide repeats-co... | 31 | 1.3 | 2 | DCMC_HUMAN (O95822) Malonyl-CoA decarboxylase, mitochondrial pre... | 28 | 8.3 |
|---|
>S3TC2_MOUSE (Q80VA5) SH3 domain and tetratricopeptide repeats-containing| protein 2 Length = 1289 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 314 DSFLPGDLNARAFSVDERAQLYSPALDRSGEC 409 DS P N+ FS +ER+ L+SP +R EC Sbjct: 328 DSCSPMSKNSAFFSDEERSSLWSPGSERKAEC 359
>DCMC_HUMAN (O95822) Malonyl-CoA decarboxylase, mitochondrial precursor (EC| 4.1.1.9) (MCD) Length = 493 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 231 SPVPGGSARRLGLRNSIQTNFGDDYVFQIASCQEI 335 SP+PG + LGL NS G + +F + C+EI Sbjct: 329 SPIPGFTKWLLGLLNSQTKEHGRNELFTDSECKEI 363 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,186,812 Number of Sequences: 219361 Number of extensions: 433888 Number of successful extensions: 1113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)