ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast69e07 |
|---|---|
| Clone Library Name | barley_pub |
>BAK1_ARATH (Q94F62) BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor (EC 2.7.11.1) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) Length = 615 Score = 31.2 bits (69), Expect = 1.0 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = +2 Query: 224 VISEADRQGLQAIKQDLSDPRGFLRSWNDTGLGGACSGAWTXIKCVNGN-VVAITLPWRG 400 V A+ L A+K L+DP L+SW D L C+ W + C + N V + L Sbjct: 23 VSGNAEGDALSALKNSLADPNKVLQSW-DATLVTPCT--WFHVTCNSDNSVTRVDLGNAN 79 Query: 401 LAGTL 415 L+G L Sbjct: 80 LSGQL 84
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.8 bits (68), Expect = 1.4 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 24 TSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRC 164 T +SC ++SP Q A P+PC+ G + P CC A+ C Sbjct: 42 TPVSC-VSSPCC---QAACEPSPCQSGCTSSCTPSCCQPACCASSPC 84
>KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-associated| protein 10.3) (High sulfur keratin-associated protein 10.3) (Keratin-associated protein 18-3) (Keratin-associated protein 18.3) Length = 221 Score = 30.4 bits (67), Expect = 1.8 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 24 TSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 167 T +SC ++SP Q A P+PC+ G + P CC SSC A S Sbjct: 48 TPVSC-VSSPCC---QAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSS 93 Score = 28.9 bits (63), Expect = 5.2 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +3 Query: 15 ATATSLSCSIASPASLRVQTADR-----PAPCRCG*AVTARPPCCSSCTAAALRC 164 A T+ C +S SL + R P P C A T +P CC + +L C Sbjct: 145 ACCTTSCCRPSSSVSLLCRPVCRSTYCVPIPSCCAPASTCQPSCCRPASCVSLLC 199
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 178 RRREEQRSAAAVQDEQQGGRAVTA*PQRHGAGRSAVCTRS 59 RRR + S + V+D + GGRA A P A R +RS Sbjct: 833 RRRRDSPSRSPVRDRESGGRAAAAAPGNSEARRGRSYSRS 872
>MT2_MOUSE (P02798) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS AS S A + C+C + + CCS C +CS Sbjct: 4 NCSCASDGSCSCAGACKCKQCKC---TSCKKSCCSCCPVGCAKCS 45
>MT2B_PIG (P79380) Metallothionein-2B (MT-2B) (Metallothionein-IIB) (MT-IIB)| Length = 61 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S + + CRC + + CCS C A RC+ Sbjct: 4 NCSCAAGGSCTCAGSCKCKDCRC---TSCKKSCCSCCPAGCARCA 45
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 29.6 bits (65), Expect = 3.0 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +3 Query: 6 SPLATATSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 167 +P T + ++ +S Q A P+PC+ G + P CC SSC A S Sbjct: 38 APAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSS 93
>MT2_MESAU (P17808) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S + + C+C T + CCS C +CS Sbjct: 4 NCSCATDGSCSCSGSCKCKECKC---TTCKKSCCSCCPVGCAKCS 45
>MT2_CRILO (P68041) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S + + C+C T + CCS C +CS Sbjct: 4 NCSCATDGSCSCAGSCKCKECKC---TTCKKSCCSCCPVGCAKCS 45
>MT2_CRIGR (P67981) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S + + C+C T + CCS C +CS Sbjct: 4 NCSCATDGSCSCAGSCKCKECKC---TTCKKSCCSCCPVGCAKCS 45
>MT1D_PIG (P79377) Metallothionein-1D (MT-1D) (Metallothionein-ID) (MT-ID)| Length = 61 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS ++ S T+ CRC + + CCS C A +C+ Sbjct: 4 NCSCSTGGSCSCATSCTCKACRC---TSCKKSCCSCCPAGCAKCA 45
>TMK1_ARATH (P43298) Putative receptor protein kinase TMK1 precursor (EC| 2.7.11.1) Length = 942 Score = 28.9 bits (63), Expect = 5.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +2 Query: 341 WTXIKCVNGNVVAITLPWRGLAGTLS 418 W I C NGN+ I+L L GT+S Sbjct: 354 WIGIACSNGNITVISLEKMELTGTIS 379
>RLK5_ARATH (P47735) Receptor-like protein kinase 5 precursor (EC 2.7.11.1)| Length = 999 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 251 LQAIKQDLSDPRGFLRSWNDTGLGGACSGAWTXIKC-VNGNVVAITL 388 L+ K LSDP L SW+D C W + C NVV++ L Sbjct: 28 LRQAKLGLSDPAQSLSSWSDNNDVTPCK--WLGVSCDATSNVVSVDL 72
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1) (Protein| kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 342 QAPEQAPPRPVSFQERRKPRGSERSCLMACRPCRSAS 232 +APE +PP P+S +G R + C P R A+ Sbjct: 1325 EAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAA 1361
>ECAR_ECHCA (Q90495) Ecarin precursor (EC 3.4.24.-)| Length = 616 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 Query: 42 IASPASLRVQTADRPAPCRCG*AVTARPPCCSSCT 146 IASPA + + C CG R PCC + T Sbjct: 402 IASPAVCGNEIWEEGEECDCGSPADCRNPCCDAAT 436
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.1 bits (61), Expect = 8.8 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = +3 Query: 9 PLATATSLSCS-----IASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 167 P+ + S SC ++ +S Q P+PC+ G + P CC SSC A S Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCKPACCTSS 222
>DEOC_NOCFA (Q5YP36) Deoxyribose-phosphate aldolase (EC 4.1.2.4)| (Phosphodeoxyriboaldolase) (Deoxyriboaldolase) (DERA) Length = 222 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 144 CRTSSRAAARLPPSRSGMAPAGLQSVHEVK 55 CR + RA A + +G PAG SVH V+ Sbjct: 144 CRVAERAGADFVKTSTGFHPAGGASVHAVR 173
>VGLI_BHV1S (Q08102) Glycoprotein I| Length = 380 Score = 28.1 bits (61), Expect = 8.8 Identities = 24/77 (31%), Positives = 31/77 (40%), Gaps = 9/77 (11%) Frame = -2 Query: 420 AERVPARPRQGSVMATTLPLTHLIXVQA---------PEQAPPRPVSFQERRKPRGSERS 268 A R PA RQ A+ L + + +A P APPR RR R E + Sbjct: 179 AARTPAPSRQSRPAASGLTSSASLYDRALARSPQAPPPRPAPPRAARAGPRRPERVDETT 238 Query: 267 CLMACRPCRSASLITTP 217 + A SA +TTP Sbjct: 239 EVEAATRAGSAFALTTP 255
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 28.1 bits (61), Expect = 8.8 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = +3 Query: 9 PLATATSLSCS-----IASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 167 P+ + S SC ++ +S Q P+PC+ G + P CC SSC A S Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSS 222
>MT2E_RABIT (P80292) Metallothionein-2E (MT-2E) (Metallothionein-IIE) (MT-IIE)| Length = 61 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATRDSCACASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>MT2D_RABIT (P80291) Metallothionein-2D (MT-2D) (Metallothionein-IID) (MT-IID)| Length = 61 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATRDSCACASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>MT2B_RABIT (P80289) Metallothionein-2B (MT-2B) (Metallothionein-IIB) (MT-IIB)| Length = 61 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATGDSCTCASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>MT1C_PIG (P79376) Metallothionein-1C (MT-1C) (Metallothionein-IC) (MT-IC)| Length = 61 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 21 ATSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +T SCS A + + CRC + + CCS C A RC+ Sbjct: 8 STGGSCSCAGSCTCKA--------CRC---TSCKKSCCSCCPAGCARCA 45
>MT1A_RABIT (P11957) Metallothionein-1A (MT-1A) (Metallothionein-IA) (MT-IA)| Length = 61 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +3 Query: 33 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 167 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATGNSCTCASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,324,099 Number of Sequences: 219361 Number of extensions: 580720 Number of successful extensions: 2601 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2582 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
