| Clone Name | bast69e04 |
|---|---|
| Clone Library Name | barley_pub |
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 114 bits (285), Expect = 6e-26 Identities = 57/66 (86%), Positives = 60/66 (90%), Gaps = 1/66 (1%) Frame = +1 Query: 76 MAKDEVMETGGG-GDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEA 252 M KDEVME+GG G+FAAKDYTDPPPAPL+DAAEL SWSLYRAVIAEFIA LLFLYIT A Sbjct: 1 MGKDEVMESGGAAGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVA 60 Query: 253 TVIGYK 270 TVIGYK Sbjct: 61 TVIGYK 66
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 100 bits (249), Expect = 1e-21 Identities = 49/65 (75%), Positives = 52/65 (80%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 MAKD GG+F+AKDYTDPPPAPL+D EL WSLYRAVIAEFIA LLFLYIT AT Sbjct: 1 MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT 60 Query: 256 VIGYK 270 VIGYK Sbjct: 61 VIGYK 65
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 97.8 bits (242), Expect = 6e-21 Identities = 48/66 (72%), Positives = 53/66 (80%), Gaps = 1/66 (1%) Frame = +1 Query: 76 MAKD-EVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEA 252 MAKD E GG++ AKDY+DPPPAPL+DA EL WSLYRAVIAEF+A LLFLYIT A Sbjct: 1 MAKDIEAAAAAEGGEYMAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVA 60 Query: 253 TVIGYK 270 TVIGYK Sbjct: 61 TVIGYK 66
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 85.9 bits (211), Expect = 2e-17 Identities = 43/65 (66%), Positives = 48/65 (73%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 M K+ +E GG +DY DPPPAPLVD EL WSLYRAVIAEF+A LLFLY+T AT Sbjct: 1 MGKEADVEAGG-----VRDYEDPPPAPLVDIDELGRWSLYRAVIAEFVATLLFLYVTVAT 55 Query: 256 VIGYK 270 VIGYK Sbjct: 56 VIGYK 60
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 85.9 bits (211), Expect = 2e-17 Identities = 43/65 (66%), Positives = 47/65 (72%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 MAKD +E G F +DY DPPPAP +D AEL WS YRAVIAEF+A LLFLYIT T Sbjct: 1 MAKD--VEAVPGEGFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT 58 Query: 256 VIGYK 270 VIGYK Sbjct: 59 VIGYK 63
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 84.3 bits (207), Expect = 7e-17 Identities = 41/59 (69%), Positives = 46/59 (77%) Frame = +1 Query: 94 METGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 +E GG A+DY DPPPAPLVD EL WSLYRA+IAEF+A LLFLY+T ATVIGYK Sbjct: 10 LEAGG-----ARDYIDPPPAPLVDVDELGKWSLYRALIAEFVATLLFLYVTVATVIGYK 63
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 82.4 bits (202), Expect = 3e-16 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = +1 Query: 73 LMAKDEV-METGGGGDFAAK-DYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYIT 246 + +K+EV +ET GG AAK Y DPPPAPL+D +EL WSLYRA+IAEF+A L+FLY++ Sbjct: 1 MASKEEVAVETVEGGAAAAKAPYWDPPPAPLLDTSELGKWSLYRALIAEFMATLIFLYVS 60 Query: 247 EATVIGYK 270 ATVIGYK Sbjct: 61 IATVIGYK 68
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 82.4 bits (202), Expect = 3e-16 Identities = 42/61 (68%), Positives = 46/61 (75%) Frame = +1 Query: 88 EVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 EV E G G KDY DPPPAPL+D AEL WS YRA+IAEFIA LLFLY+T ATVIG+ Sbjct: 4 EVSEEGRHG----KDYVDPPPAPLLDMAELKLWSFYRAIIAEFIATLLFLYVTVATVIGH 59 Query: 268 K 270 K Sbjct: 60 K 60
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 82.0 bits (201), Expect = 4e-16 Identities = 39/48 (81%), Positives = 40/48 (83%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDYTDPPPAPL D EL WS YRA+IAEFIA LLFLYIT ATVIGYK Sbjct: 15 KDYTDPPPAPLFDVGELRLWSFYRALIAEFIATLLFLYITVATVIGYK 62
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 81.6 bits (200), Expect = 5e-16 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 MAKD G F +DY DPPP P DA EL WSLYRAVIAEF+A LLFLY+T T Sbjct: 1 MAKD----VEGPDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT 56 Query: 256 VIGYK 270 VIGYK Sbjct: 57 VIGYK 61
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 81.3 bits (199), Expect = 6e-16 Identities = 42/65 (64%), Positives = 44/65 (67%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 MAKD G F +DY DPPP P DA EL WSLYRAVIAEF+A LLFLYIT T Sbjct: 1 MAKD----VEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT 56 Query: 256 VIGYK 270 VIGYK Sbjct: 57 VIGYK 61
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 80.9 bits (198), Expect = 8e-16 Identities = 38/56 (67%), Positives = 41/56 (73%) Frame = +1 Query: 103 GGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 G F+ KDY DPPP PL DA EL WS YRA+IAEFIA LLFLY+T TVIGYK Sbjct: 7 GDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIGYK 62
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 80.5 bits (197), Expect = 1e-15 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY DPPPAPL+D EL SWS YRA+IAEFIA LLFLY+T ATVIG+K Sbjct: 15 KDYVDPPPAPLLDMGELKSWSFYRALIAEFIATLLFLYVTVATVIGHK 62
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 80.1 bits (196), Expect = 1e-15 Identities = 40/65 (61%), Positives = 46/65 (70%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 MAKD ++ G AA+DY DPPPAP D EL W LYRAVIAEF+A LLFLY++ T Sbjct: 1 MAKD--LDVNESGPPAARDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILT 58 Query: 256 VIGYK 270 VIGYK Sbjct: 59 VIGYK 63
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 77.0 bits (188), Expect = 1e-14 Identities = 40/65 (61%), Positives = 44/65 (67%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 M+K+ + E G KDY DPPPAP D EL WS +RA IAEFIA LLFLYIT AT Sbjct: 1 MSKEVISEEGQVHQHG-KDYVDPPPAPFFDMGELKLWSFWRAAIAEFIATLLFLYITVAT 59 Query: 256 VIGYK 270 VIGYK Sbjct: 60 VIGYK 64
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/65 (56%), Positives = 42/65 (64%) Frame = +1 Query: 76 MAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEAT 255 M KDE+ E + KDY DPPP + EL WS YRAVIAEFIA LLFLY+T T Sbjct: 1 MTKDELTEEES---LSGKDYLDPPPVKTFEVRELKKWSFYRAVIAEFIATLLFLYVTVLT 57 Query: 256 VIGYK 270 VIG+K Sbjct: 58 VIGFK 62
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/59 (61%), Positives = 39/59 (66%) Frame = +1 Query: 94 METGGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 M G G KDY DPPPAPLVD EL WSLYRA IAEF A LL + I+ +TVIG K Sbjct: 1 MAAGSGSGSNPKDYQDPPPAPLVDTGELGKWSLYRAAIAEFTATLLLVCISVSTVIGEK 59
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 70.1 bits (170), Expect = 1e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY +PPPAPL + EL+SWS YRA IAEFIA LFLYIT TV+G K Sbjct: 30 KDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVK 77
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 69.3 bits (168), Expect = 2e-12 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY +PPPAPL + ELASWS +RA IAEFIA LFLYIT TV+G K Sbjct: 29 KDYKEPPPAPLFEPGELASWSFWRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 68.6 bits (166), Expect = 4e-12 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY +PPPAPL + EL+SWS YRA IAEF+A LFLYIT TV+G K Sbjct: 30 KDYKEPPPAPLFEPGELSSWSFYRAGIAEFMATFLFLYITILTVMGLK 77
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 68.6 bits (166), Expect = 4e-12 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY +PPPAP + EL+SWS YRA IAEFIA LFLYIT TV+G K Sbjct: 29 KDYKEPPPAPFFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 68.6 bits (166), Expect = 4e-12 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIG 264 KDY +PPPAPL + +EL SWS YRA IAEFIA LFLYIT TV+G Sbjct: 32 KDYQEPPPAPLFEPSELTSWSFYRAGIAEFIATFLFLYITVLTVMG 77
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 68.2 bits (165), Expect = 5e-12 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +1 Query: 106 GGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIG 264 G GD KDY +PPPAPL + EL SWS YRA IAEF+A LFLYIT TV+G Sbjct: 27 GAGD--DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMG 77
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +1 Query: 103 GGGGDFAAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 G +KDY +PPPAP + EL SWS YRA IAEFIA LFLY+T TV+G K Sbjct: 22 GTAAQTESKDYKEPPPAPFFEPGELKSWSFYRAGIAEFIATFLFLYVTVLTVMGVK 77
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 66.6 bits (161), Expect = 2e-11 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY +PPPAP + EL+SWS +RA IAEFIA LFLYIT TV+G K Sbjct: 29 KDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 66.6 bits (161), Expect = 2e-11 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 KDY +PPPAP + EL+SWS +RA IAEFIA LFLYIT TV+G K Sbjct: 29 KDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVK 76
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 61.6 bits (148), Expect = 5e-10 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +1 Query: 127 KDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIG 264 KDY +PP AP+ + EL SWS YRA IAEF+A LFLYI+ TV+G Sbjct: 31 KDYREPPAAPVFEVEELTSWSFYRAGIAEFVATFLFLYISILTVMG 76
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 33.1 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 A+E +RAV+AEF+A LF++I+ + +G+K Sbjct: 1 ASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFK 35
>AQPA_RANES (P50501) Aquaporin FA-CHIP| Length = 272 Score = 33.1 bits (74), Expect = 0.19 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A+E + +RAVIAEF+A +LF++I+ +G+ Sbjct: 2 ASEFKKKAFWRAVIAEFLAMILFVFISIGAALGF 35
>AQP1_PONPY (Q5R819) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 A+E +RAV+AEF+A LF++I+ + +G+K Sbjct: 1 ASEFKKKLFWRAVVAEFLAMTLFVFISIGSALGFK 35
>AQP1_SHEEP (P56401) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 271 Score = 32.3 bits (72), Expect = 0.32 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A+E +RAV+AEF+A +LF++I+ + +G+ Sbjct: 1 ASEFKKKLFWRAVVAEFLAMILFIFISIGSALGF 34
>AQP1_BOVIN (P47865) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Water channel protein CHIP29) Length = 270 Score = 32.3 bits (72), Expect = 0.32 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A+E +RAV+AEF+A +LF++I+ + +G+ Sbjct: 1 ASEFKKKLFWRAVVAEFLAMILFIFISIGSALGF 34
>AQP1_CANFA (Q9N2J4) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A+E +RAV+AEF+A +LF++I+ + +G+ Sbjct: 1 ASEFKKKLFWRAVVAEFLAMILFVFISIGSALGF 34
>AQP1_RAT (P29975) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A+E+ +RAV+AEF+A LF++I+ + +G+ Sbjct: 1 ASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGF 34
>AQP1_MOUSE (Q02013) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Early response protein DER2) Length = 268 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A+E+ +RAV+AEF+A LF++I+ + +G+ Sbjct: 1 ASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGF 34
>AQP1_PIG (Q6PQZ1) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/35 (37%), Positives = 24/35 (68%) Frame = +1 Query: 166 AAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 A+E +RAV+AEF+A LF++I+ + +G++ Sbjct: 1 ASEFKKKIFWRAVVAEFLAMTLFIFISIGSALGFQ 35
>NCBP1_HUMAN (Q09161) Nuclear cap-binding protein subunit 1 (80 kDa nuclear| cap-binding protein) (NCBP 80 kDa subunit) (CBP80) Length = 790 Score = 29.6 bits (65), Expect = 2.1 Identities = 24/71 (33%), Positives = 31/71 (43%) Frame = +1 Query: 1 LPPVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAELA 180 LPP TPPPHT +S++ P + F DYTD P P++ Sbjct: 268 LPPFTPPPHT-EDSVY---PMPRVI--------------FRMFDYTDDPEGPVMP----G 305 Query: 181 SWSLYRAVIAE 213 S S+ R VI E Sbjct: 306 SHSVERFVIEE 316
>TLR21_CHICK (Q9DD78) Toll-like receptor 2 type-1 precursor| Length = 793 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 160 VDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 V + +L+ +R+++ I L+FL+I V+GYK Sbjct: 584 VGSVQLSLMECHRSLLVSLICTLVFLFILILVVVGYK 620
>TLR22_CHICK (Q9DGB6) Toll-like receptor 2 type-2 precursor| Length = 781 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 160 VDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGYK 270 V + +L+ +R+++ I L+FL+I V+GYK Sbjct: 572 VGSVQLSLMECHRSLLVSLICTLVFLFILILVVVGYK 608
>GCSP_BRUSU (Q8FVU9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +1 Query: 7 PVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLVD 165 P+ PHT+S+++ + + P+T ++E + GG D AK + PP VD Sbjct: 867 PLANAPHTASDTLATEWKHPYT---REEAVFPGGAFDPTAKYW---PPVSRVD 913
>GCSP_BRUME (P62921) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +1 Query: 7 PVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLVD 165 P+ PHT+S+++ + + P+T ++E + GG D AK + PP VD Sbjct: 867 PLANAPHTASDTLATEWKHPYT---REEAVFPGGAFDPTAKYW---PPVSRVD 913
>GCSP_BRUAB (P62920) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +1 Query: 7 PVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLVD 165 P+ PHT+S+++ + + P+T ++E + GG D AK + PP VD Sbjct: 867 PLANAPHTASDTLATEWKHPYT---REEAVFPGGAFDPTAKYW---PPVSRVD 913
>GCSP_BRUA2 (Q2YKX9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +1 Query: 7 PVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLVD 165 P+ PHT+S+++ + + P+T ++E + GG D AK + PP VD Sbjct: 867 PLANAPHTASDTLATEWKHPYT---REEAVFPGGAFDPTAKYW---PPVSRVD 913
>VE4_HPV5B (P26550) Probable protein E4| Length = 245 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +1 Query: 4 PPVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLVDAAE 174 PP P PH + + ++P ++ E GGD ++ PPP P + E Sbjct: 149 PPTPPAPHNGHSGHGPKVQQPEGPEGREGHEEGAVGGDCGDEEGHPPPPPPPTNGHE 205
>MURC_BIFLO (Q8G4Q4) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 512 Score = 28.1 bits (61), Expect = 6.1 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 22 PHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAK----DYTDPPPAPLVDAA 171 PH S + FF + +L D+V+ T G F A+ D+ D P+ +VDAA Sbjct: 400 PHLFSRTKFFAHQFAKSLAKADDVIIT---GIFPAREKQADFPDISPSTIVDAA 450
>AQP2_SHEEP (O62735) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 172 ELASWSLYRAVIAEFIAPLLFLY 240 EL S + RAV+AEF+A LLF++ Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVF 25
>AQP2_RAT (P34080) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 172 ELASWSLYRAVIAEFIAPLLFLY 240 EL S + RAV+AEF+A LLF++ Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVF 25
>AQP2_MOUSE (P56402) Aquaporin-2 (AQP-2) (Aquaporin-CD) (AQP-CD) (Water channel| protein for renal collecting duct) (ADH water channel) (Collecting duct water channel protein) (WCH-CD) Length = 271 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 172 ELASWSLYRAVIAEFIAPLLFLY 240 EL S + RAV+AEF+A LLF++ Sbjct: 3 ELRSIAFSRAVLAEFLATLLFVF 25
>ALGD_PSEPK (Q88NC4) GDP-mannose 6-dehydrogenase (EC 1.1.1.132) (GMD)| Length = 438 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 121 AAKDYTDPPPAPLVDAAELASWSLYRAVIAEFIAPLLFLYITEATVIGY 267 A KDY D PP ++ + AS + +A+ E AP++ I A +I Y Sbjct: 164 AIKDY-DQPPMTVIGELDSASGDILQALYEELDAPIIRKPIEVAEMIKY 211
>FOXO4_HUMAN (P98177) Putative fork head domain transcription factor AFX1| (Forkhead box protein O4) Length = 505 Score = 27.7 bits (60), Expect = 8.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 4 PPVTPPPHTSSNSIFFQREEPHTLMAKDEVMETGGGGDFAAKDYTDPPPAPLV 162 P VT P HT S+S+F E P L A + + + T PPPA ++ Sbjct: 332 PGVTGPLHTYSSSLFSPAEGP--LSAGEGCFSSSQALEALLTSDTPPPPADVL 382
>MIER1_CHICK (Q5ZKT9) Mesoderm induction early response protein 1 (Mi-er1)| Length = 513 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +1 Query: 19 PPHTSSNSIFFQ--REEPHTLMAKDEVMETGGGGDFAAKDYTDP 144 PP T+SNS Q RE+ T + + G GD +KD P Sbjct: 380 PPPTASNSSTSQSEREDSTTSSSNQNGLSANGPGDIPSKDEAKP 423 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,612,702 Number of Sequences: 219361 Number of extensions: 481725 Number of successful extensions: 2208 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 2118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2203 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)