| Clone Name | bast69c11 |
|---|---|
| Clone Library Name | barley_pub |
>CRR1_ASHGO (Q75A41) Probable glycosidase CRR1 precursor (EC 3.2.-.-)| (CRH-related protein 1) Length = 450 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 262 RLQHHHRALPHVPSLPVSRT 203 R QHH R+LPHV + P++ T Sbjct: 430 RQQHHRRSLPHVEAPPITNT 449
>ATPD_HUMAN (P30049) ATP synthase delta chain, mitochondrial precursor (EC| 3.6.3.14) Length = 168 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 280 RRPGLGRLQHHHRALPHVPSLPVSRTRANE 191 RRPGLGRL H RA + P + + N+ Sbjct: 8 RRPGLGRLVRHARAYAEAAAAPAAASGPNQ 37
>CACP_COLLI (P52826) Carnitine O-acetyltransferase precursor (EC 2.3.1.7)| (Carnitine acetylase) (CAT) (Carnitine acetyltransferase) (CrAT) Length = 627 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 265 GRLQHHHRALPHVPSLPVSRT 203 GR Q H ALPH+P P+ +T Sbjct: 27 GRFQLHQEALPHLPVPPLQQT 47
>APEX1_BOVIN (P23196) DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18)| (AP endonuclease 1) (APEX nuclease) (APEN) Length = 317 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 197 RPGARDRERRDMGEGAVVVLEPPKPR-SPRG 286 + GA+ E+ +GEGAV+ +PP + SP G Sbjct: 26 KAGAKKNEKEAVGEGAVLYEDPPDQKTSPSG 56
>PDGFA_XENLA (P13698) Platelet-derived growth factor A chain precursor (PDGF| A-chain) (Platelet-derived growth factor alpha polypeptide) (PDGF-1) Length = 226 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 253 HHHRALPHVPSLPVSRTRANEEGLPS 176 HH+R +P S+P R R+ EE +P+ Sbjct: 74 HHNRLVPEKRSVPSRRKRSVEEAVPA 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,512,998 Number of Sequences: 219361 Number of extensions: 323555 Number of successful extensions: 1248 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)