| Clone Name | bast69c09 |
|---|---|
| Clone Library Name | barley_pub |
>NCPR_DROME (Q27597) NADPH--cytochrome P450 reductase (EC 1.6.2.4) (CPR)| (P450R) Length = 679 Score = 33.9 bits (76), Expect = 0.16 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +3 Query: 237 PSAPVSKELAAVRAMDEEEEILRSVDRDNKEGKEFVDSWDKRFQETCELLKQVRE 401 P + KELA ++E+E+LRS+ + EGKE SW Q+ C + + E Sbjct: 385 PRTHILKELAEYCTDEKEKELLRSMASISPEGKEKYQSW---IQDACRNIVHILE 436
>Y5390_ARATH (Q8GW20) Protein At5g03900 precursor| Length = 523 Score = 32.3 bits (72), Expect = 0.45 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = +3 Query: 234 SPSAPVSKELAAVRAMDEE-----EEILRSVDRDNKEGKEFVDSWDKRFQE 371 SP + ++L + R M ++ + I+ S DRD E D WD+RF+E Sbjct: 468 SPDIALRRKLLSARDMAQKTVIGKDRIVYSTDRDMMEQNYETDEWDRRFKE 518
>HSP82_MAIZE (Q08277) Heat shock protein 82| Length = 715 Score = 30.8 bits (68), Expect = 1.3 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 255 KELAAVRAMDEEEEILRSVDRDNKEGKEFVDSWDKRFQETCELLKQV 395 KE + + +E L+ D D++E K+ + KRF+E C+++K + Sbjct: 520 KEYDGKKLVSATKEGLKLDDEDDEEAKKRREERKKRFEELCKVIKDI 566
>ZC3H5_HUMAN (Q9C0B0) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 30.8 bits (68), Expect = 1.3 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 14/83 (16%) Frame = +3 Query: 195 DHFDGSASAVGRPSP---SAPVSKELAAVRA-MDEEEEILRSVDRDNKEGKEFVDSWDKR 362 +HF + + G SP S P + ELA +R +DE ++ + K+ K+ D+W K Sbjct: 623 EHFASGSFSPGT-SPAFLSGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKE 681 Query: 363 FQET----------CELLKQVRE 401 +E CEL ++ R+ Sbjct: 682 AEEAGERASAAGAECELAREQRD 704
>Y1900_AQUAE (O67738) Hypothetical protein aq_1900| Length = 168 Score = 30.4 bits (67), Expect = 1.7 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +3 Query: 282 DEEEEILRSVDRDNKEGKEFVDSWDKRFQETCELLKQVRE 401 +EE++++R + K F++ DKRFQ+ + + ++RE Sbjct: 22 EEEKQLIRDIAEIKATLKTFMEQTDKRFQDLNQRINELRE 61
>ZC3H5_MOUSE (Q8BL48) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 30.0 bits (66), Expect = 2.3 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 14/83 (16%) Frame = +3 Query: 195 DHFDGSASAVGRPSP---SAPVSKELAAVRA-MDEEEEILRSVDRDNKEGKEFVDSWDKR 362 +HF + + G SP S P + ELA +R +DE ++ + K+ K+ D+W K Sbjct: 623 EHFASGSFSPGT-SPAFLSGPGAAELARLRQELDEANGTIKQWEESWKQAKQACDAWKKE 681 Query: 363 FQET----------CELLKQVRE 401 +E CEL ++ R+ Sbjct: 682 AEEAGERASAAGAECELAREQRD 704
>FLAB2_TREHY (P80160) Flagellar filament core protein flaB2 (34 kDa core| protein) Length = 285 Score = 29.6 bits (65), Expect = 2.9 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 261 LAAVRAMDEEEEILRSVDRDNKEGKEFVDSWDKRFQETCELLKQVRE 401 LA M + LR +R+N G F+ + + QE+ ++L+++RE Sbjct: 46 LAVSEKMRTQIRGLRQAERNNSSGISFIQTTEGYLQESQDILQRIRE 92
>NCPR_HUMAN (P16435) NADPH--cytochrome P450 reductase (EC 1.6.2.4) (CPR)| (P450R) Length = 676 Score = 28.9 bits (63), Expect = 5.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 237 PSAPVSKELAAVRAMDEEEEILRSVDRDNKEGKEFVDSW 353 P V ELA + E+E+LR + + EGKE SW Sbjct: 380 PRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSW 418
>ASSY_AQUAE (O67213) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 401 Score = 28.9 bits (63), Expect = 5.0 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 201 FDGSASAVGRPSPSAPVSKELAAVRAMDEEEEILRSVDRDNKEGKEFVDSW 353 + GS S VGR SP++ +ELA D+ ++I GK F W Sbjct: 346 YKGSVSVVGRRSPNSLYVEELATYSEKDQFDQI---------AGKHFTKVW 387
>RM21_ARATH (Q8L9A0) 50S ribosomal protein L21, mitochondrial precursor| Length = 270 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 282 DEEEEILRSVDRDNKEGKEFVDSWDKRFQETCELLKQVRE 401 DE+EE D D +EG++F DS D + ++V E Sbjct: 76 DEDEESSEGEDDDEEEGEDFEDSADMEVEREYSPAEKVEE 115
>HIS82_CARHZ (Q3AAT6) Histidinol-phosphate aminotransferase 2 (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase 2) Length = 362 Score = 28.5 bits (62), Expect = 6.6 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 228 RPSPSAPVSKELAAVRAMDEEEEILRSVDRDNKEGKEFV 344 RP + ++AAV A+D+EE + R V ++ EGK+F+ Sbjct: 248 RPPFNVNFLAQMAAVAALDDEEYV-REVVKNTDEGKKFL 285
>YBAB_BACCI (P48843) Hypothetical protein in bgaB 5'region (ORF1) (Fragment)| Length = 366 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +3 Query: 261 LAAVRAMDEEEEILRSVDR--DNKEGKEFVDSWD 356 +AAV+++D E +I+ +DR DN E ++F D ++ Sbjct: 173 IAAVKSVDSEIKIMIHIDRGGDNAESRKFYDRFE 206
>ASF1_YEAST (P32447) Anti-silencing protein 1| Length = 279 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 279 MDEEEEILRSVDRDNKEGKEFVDSWDK 359 ++EEEE + + D D +EG+E V S DK Sbjct: 222 LEEEEEDIENSDGDEEEGEEEVGSVDK 248
>NCPR_MUSDO (Q07994) NADPH--cytochrome P450 reductase (EC 1.6.2.4) (CPR)| (P450R) Length = 671 Score = 28.1 bits (61), Expect = 8.6 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +3 Query: 237 PSAPVSKELAAVRAMDEEEEILRSVDRDNKEGKEFVDSW----DKRFQETCELLKQVREP 404 P + KELA + ++++E LR++ EGKE +W + E +K R P Sbjct: 378 PRTHILKELAEYCSDEKDKEFLRNMASITPEGKEKYQNWIQNSSRNIVHILEDIKSCRPP 437
>ARE2_SACBA (Q876L2) Sterol O-acyltransferase 2 (EC 2.3.1.26) (Sterol-ester| synthase 2) Length = 650 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 15 QERSRKMFALRKTLLHGRLPAPPATAA 95 ++R +++ A+RK L HG+ PAP A AA Sbjct: 165 RKREKELMAMRKNLHHGK-PAPDADAA 190
>SMC4_CAEEL (Q20060) Structural maintenance of chromosome 4 (Protein smc-4)| Length = 1549 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +3 Query: 240 SAPVSKELAAVRAMDEEEEILRSVDRDNKEGKEFVDSWDKRFQETCELLKQVRE 401 +AP E + +E E++L N+E + +D ++KR + E K+++E Sbjct: 436 AAPEKAERKIAKCQEEVEQLLEIEKTANEEADKNLDEFEKRSEAPKEEQKKIQE 489
>TBX22_MOUSE (Q8K402) T-box transcription factor TBX22 (T-box protein 22)| Length = 517 Score = 28.1 bits (61), Expect = 8.6 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = +3 Query: 189 TKDHFDGSASAVGRPS------PSAPVSKELAAVRAMDEEEEILRSVDRDNKE 329 ++ H + +GRPS P + EL + ++E EEILRS RD+++ Sbjct: 5 SRAHAFSVEALMGRPSKRKAQDPREEMQPELQEEQFVEEGEEILRSPSRDSQQ 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.125 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,215,092 Number of Sequences: 219361 Number of extensions: 499111 Number of successful extensions: 2777 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2772 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)