| Clone Name | bast69c08 |
|---|---|
| Clone Library Name | barley_pub |
>DOF57_ARATH (Q9LSL6) Dof zinc finger protein DOF5.7 (AtDOF5.7)| Length = 316 Score = 89.4 bits (220), Expect = 4e-18 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKP 139 CY+NNYSLSQPRHFC++CRRYWTRGGALRNVP+GGG R+ K KP Sbjct: 54 CYYNNYSLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKSIKP 99
>DOF36_ARATH (Q9M2U1) Dof zinc finger protein DOF3.6 (AtDOF3.6) (OBF-binding| protein 3) Length = 323 Score = 89.0 bits (219), Expect = 5e-18 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPK 142 CYFNNYSL+QPRHFC+ CRRYWTRGG+LRNVPVGGG+RR+ KR+K + Sbjct: 89 CYFNNYSLTQPRHFCKTCRRYWTRGGSLRNVPVGGGFRRN-KRSKSR 134
>DOF22_ARATH (Q9ZV33) Dof zinc finger protein DOF2.2 (AtDOF2.2)| Length = 340 Score = 88.2 bits (217), Expect = 8e-18 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CYFNNY+L+QPRHFC+ACRRYWTRGGALRNVPVGGG RR+ K Sbjct: 107 CYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKK 148
>DOF14_ARATH (Q9FZA4) Hypothetical Dof zinc finger protein DOF1.4 (AtDOF1.4)| Length = 311 Score = 87.4 bits (215), Expect = 1e-17 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKP 139 CY+NNYSLSQPRHFC+AC+RYWTRGG LRNVPVGG YR++ + +P Sbjct: 40 CYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVKRP 85
>DOF51_ARATH (Q9LZ56) Dof zinc finger protein DOF5.1 (AtDOF5.1)| Length = 399 Score = 87.0 bits (214), Expect = 2e-17 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAK 136 CYFNNYSL+QPRHFC+ACRRYWTRGGALR+VPVGGG RR+ KR K Sbjct: 108 CYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRN-KRTK 151
>DOF24_ARATH (O80928) Dof zinc finger protein DOF2.4 (AtDOF2.4)| Length = 330 Score = 86.7 bits (213), Expect = 2e-17 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CYFNNYSL+QPRHFC+ CRRYWTRGGALRNVPVGGG RR+ + Sbjct: 102 CYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRR 143
>DOF54_ARATH (Q8LDR0) Dof zinc finger protein DOF5.4 (AtDOF5.4) (OBF-binding| protein 4) Length = 307 Score = 86.7 bits (213), Expect = 2e-17 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPKQ 145 CY+NNY+LSQPRHFC+ CRRYWT+GG LRNVPVGGG R+ AKR+K KQ Sbjct: 64 CYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRK-AKRSKTKQ 110
>DOF11_ARATH (Q8L9V6) Dof zinc finger protein DOF1.1 (AtDOF1.1) (OBF-binding| protein 2) Length = 331 Score = 86.3 bits (212), Expect = 3e-17 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAK 136 CY+NNY+L+QPRHFC+ CRRYWT+GGALRNVPVGGG RR+ K+ K Sbjct: 90 CYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRRNNKKGK 134
>DOF31_ARATH (Q94AR6) Dof zinc finger protein DOF3.1 (AtDOF3.1)| Length = 204 Score = 85.1 bits (209), Expect = 7e-17 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 130 CY+NNY+LSQPRHFC++CRRYWT+GGALRNVPVGGG R++A + Sbjct: 42 CYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNATK 84
>DOF34_ARATH (Q39088) Dof zinc finger protein DOF3.4 (AtDOF3.4) (OBF-binding| protein 1) Length = 253 Score = 84.3 bits (207), Expect = 1e-16 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAK 136 CY+NNY+ SQPRHFC+ACRRYWT GG LR+VPVGGG R+ AKR++ Sbjct: 43 CYYNNYNFSQPRHFCKACRRYWTHGGTLRDVPVGGGTRKSAKRSR 87
>DOF17_ARATH (O82155) Dof zinc finger protein DOF1.7 (AtDOF1.7)| Length = 194 Score = 84.3 bits (207), Expect = 1e-16 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRA 133 CY+NNY+LSQPRHFC+ CRRYWT+GGALRN+PVGGG R+ KR+ Sbjct: 46 CYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKSNKRS 89
>DOF32_ARATH (Q9M1E6) Dof zinc finger protein DOF3.2 (AtDOF3.2)| Length = 245 Score = 83.6 bits (205), Expect = 2e-16 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSLSQPR+FC++CRRYWT+GG LRN+P+GG YR+H + Sbjct: 53 CYYNNYSLSQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKR 94
>DOF21_ARATH (Q8LE43) Dof zinc finger protein DOF2.1 (AtDOF2.1)| Length = 288 Score = 82.0 bits (201), Expect = 6e-16 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSLSQPR+FC++CRRYWT+GG LRNVPVGGG RR+ + Sbjct: 61 CYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKR 102
>DOF56_ARATH (Q9FM03) Dof zinc finger protein DOF5.6 (AtDOF5.6)| Length = 372 Score = 81.3 bits (199), Expect = 1e-15 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSLSQPR+FC+ CRRYWT+GG LRN+PVGGG R++ K Sbjct: 86 CYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKK 127
>DOF12_ARATH (P68349) Hypothetical Dof zinc finger protein DOF1.2 (AtDOF1.2)| Length = 260 Score = 80.9 bits (198), Expect = 1e-15 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSLSQPR+FC+ CRRYWT+GG+LRN+PVGGG R+ ++ Sbjct: 51 CYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSR 92
>PBF_MAIZE (O24463) Dof zinc finger protein PBF (Prolamin box-binding factor)| Length = 328 Score = 80.9 bits (198), Expect = 1e-15 Identities = 33/45 (73%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYR--RHAKR 130 CY+NNYS+SQPR+FC+ACRRYWT GG LRNVP+GGG R +HA R Sbjct: 73 CYYNNYSMSQPRYFCKACRRYWTHGGTLRNVPIGGGCRKNKHASR 117
>DOF47_ARATH (Q84K52) Dof zinc finger protein DOF4.7 (AtDOF4.7)| Length = 246 Score = 80.1 bits (196), Expect = 2e-15 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSLSQPRH+C+ CRRYWTRGGALRNVP+GG R K Sbjct: 54 CYYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIGGSTRNKNK 95
>DOF53_ARATH (Q84TE9) Dof zinc finger protein DOF5.3 (AtDOF5.3)| Length = 257 Score = 79.3 bits (194), Expect = 4e-15 Identities = 29/42 (69%), Positives = 39/42 (92%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSL+QPR+FC++CRRYWT+GG LRN+PVGGG R++ + Sbjct: 68 CYYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKR 109
>DOF35_ARATH (Q9SVC5) Hypothetical Dof zinc finger protein DOF3.5 (AtDOF3.5)| Length = 247 Score = 79.3 bits (194), Expect = 4e-15 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPK 142 CY+NNYSL+QPR+FC+ CRRYWT+GG+LRNVPVGGG R K +PK Sbjct: 38 CYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCR---KSRRPK 81
>DOF37_ARATH (Q43385) Dof zinc finger protein DOF3.7 (AtDOF3.7) (Dof affecting| germination 1) (Transcription factor BBFa) (AtBBFa) (RolB domain B factor a) Length = 296 Score = 79.0 bits (193), Expect = 5e-15 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKP 139 CY+NNYSL+QPR+FC+ CRRYWT GG+LRNVPVGG R++ + + P Sbjct: 87 CYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSTP 132
>MNB1A_MAIZE (P38564) Dof zinc finger protein MNB1A| Length = 238 Score = 79.0 bits (193), Expect = 5e-15 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRR 118 CY+NNY+ SQPRHFC+ CRRYWT+GG LRNVPVGGG R+ Sbjct: 60 CYYNNYNTSQPRHFCKGCRRYWTKGGTLRNVPVGGGTRK 98
>DOF46_ARATH (Q8LAP8) Dof zinc finger protein DOF4.6 (AtDOF4.6)| Length = 342 Score = 78.6 bits (192), Expect = 6e-15 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSL+QPR+FC+ CRRYWT GG+LRN+PVGGG R++ + Sbjct: 66 CYYNNYSLTQPRYFCKGCRRYWTEGGSLRNIPVGGGSRKNKR 107
>DOF41_ARATH (Q9M161) Dof zinc finger protein DOF4.1 (AtDOF4.1)| Length = 294 Score = 78.6 bits (192), Expect = 6e-15 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKP 139 CY+NNYSL+QPR+ C++CRRYWT GG+LRNVPVGGG R++ K P Sbjct: 81 CYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKKLPFP 126
>DOF58_ARATH (Q9FGD6) Hypothetical Dof zinc finger protein DOF5.8 (AtDOF5.8)| Length = 225 Score = 78.2 bits (191), Expect = 8e-15 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAK 136 CY+NNY+ SQPRHFC++CRRYWT GG LR++PVGG R+ +KR++ Sbjct: 45 CYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKSSKRSR 89
>DOF18_ARATH (Q84JQ8) Dof zinc finger protein DOF1.8 (AtDOF1.8)| Length = 352 Score = 77.8 bits (190), Expect = 1e-14 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSL+QPR+FC+ CRRYWT GG+LRN+PVGGG R++ + Sbjct: 62 CYYNNYSLTQPRYFCKDCRRYWTAGGSLRNIPVGGGVRKNKR 103
>DOF25_ARATH (Q9ZPY0) Dof zinc finger protein DOF2.5 (AtDOF2.5) (Dof affecting| germination 2) Length = 369 Score = 76.6 bits (187), Expect = 2e-14 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAK 127 CY+NNYSL+QPR+FC+ CRRYWT GG+LRNVPVGG R++ + Sbjct: 93 CYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKR 134
>DOF15_ARATH (P68350) Dof zinc finger protein DOF1.5 (AtDOF1.5)| Length = 175 Score = 76.3 bits (186), Expect = 3e-14 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRR 118 CYFNNY+++QPRHFC+ C+RYWT GGALRNVPVG G R+ Sbjct: 75 CYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRK 113
>DOF16_ARATH (Q9SX97) Hypothetical Dof zinc finger protein DOF1.6 (AtDOF1.6)| Length = 209 Score = 76.3 bits (186), Expect = 3e-14 Identities = 28/43 (65%), Positives = 39/43 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKR 130 CY+NNY+L+QPR++C++CRRYWT+GG LR+VPVGGG RR + + Sbjct: 42 CYYNNYNLAQPRYYCKSCRRYWTQGGTLRDVPVGGGTRRSSSK 84
>DOF23_ARATH (O22967) Dof zinc finger protein DOF2.3 (AtDOF2.3)| Length = 170 Score = 75.9 bits (185), Expect = 4e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRR 118 CYFNNY+++QPRHFC+ C RYWT GGALRNVPVG G R+ Sbjct: 71 CYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRK 109
>DOF33_ARATH (Q8LFV3) Dof zinc finger protein DOF3.3 (AtDOF3.3) (H-protein| promoter-binding factor 2a) Length = 448 Score = 75.1 bits (183), Expect = 7e-14 Identities = 27/40 (67%), Positives = 36/40 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRH 121 CY+NNY+++QPRHFC+AC+RYWT GG +RNVPVG G R++ Sbjct: 123 CYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKN 162
>DOF44_ARATH (Q9SUA9) Hypothetical Dof zinc finger protein DOF4.4 (AtDOF4.4)| Length = 210 Score = 73.9 bits (180), Expect = 2e-13 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPKQ 145 C++NNYS SQPR+FC+ CRRYWT GGALRN+PVGG R+ KR K Q Sbjct: 37 CFYNNYSESQPRYFCKNCRRYWTHGGALRNIPVGGSCRK-PKRLKVDQ 83
>DOF43_ARATH (Q9SUB0) Hypothetical Dof zinc finger protein DOF4.3 (AtDOF4.3)| Length = 232 Score = 73.2 bits (178), Expect = 3e-13 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPKQ 145 CY+NNYS QPR+FC+ CRRYWT GGALRNVP+GG R AKR + Q Sbjct: 38 CYYNNYSEFQPRYFCKNCRRYWTHGGALRNVPIGGSSR--AKRTRINQ 83
>DOF52_ARATH (Q93ZL5) Dof zinc finger protein DOF5.2 (AtDOF5.2)| Length = 457 Score = 73.2 bits (178), Expect = 3e-13 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRA 133 CY+NNY+++QPRHFC+ C+RYWT GG +RNVPVG G R++ A Sbjct: 151 CYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSPA 194
>DOF45_ARATH (O49550) Hypothetical Dof zinc finger protein DOF4.5 (AtDOF4.5)| Length = 249 Score = 72.8 bits (177), Expect = 3e-13 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRHAKRAKPKQ 145 CY+NNY QPR+FC+ CRRYWT GGALRN+P+GG R AKRA+ Q Sbjct: 38 CYYNNYCEFQPRYFCKNCRRYWTHGGALRNIPIGGSSR--AKRARVNQ 83
>DOF55_ARATH (Q8W1E3) Dof zinc finger protein DOF5.5 (AtDOF5.5)| Length = 298 Score = 72.4 bits (176), Expect = 4e-13 Identities = 25/40 (62%), Positives = 36/40 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRH 121 CY+NNY+++QPRHFC+AC+RYWT GG +R+VP+G G R++ Sbjct: 67 CYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKN 106
>DOF1A_ARATH (Q9SEZ3) Dof zinc finger protein DOF1.10 (AtDOF1.10) (H-protein| promoter-binding factor 2b) Length = 399 Score = 71.6 bits (174), Expect = 8e-13 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRH 121 CY+NNY+++QPR+FCR C+RYWT GG++RNVPVG G R++ Sbjct: 145 CYYNNYNVNQPRYFCRNCQRYWTAGGSMRNVPVGSGRRKN 184
>DOF13_ARATH (Q9LQX4) Hypothetical Dof zinc finger protein DOF1.3 (AtDOF1.3)| Length = 366 Score = 70.9 bits (172), Expect = 1e-12 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +2 Query: 2 CYFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGGGYRRH 121 CY+NNY+++QPRHFCR C+RYWT GG++R VPVG G R++ Sbjct: 118 CYYNNYNVNQPRHFCRKCQRYWTAGGSMRIVPVGSGRRKN 157
>DOF42_ARATH (Q9SUB1) Hypothetical Dof zinc finger protein DOF4.2 (AtDOF4.2)| Length = 194 Score = 50.8 bits (120), Expect = 1e-06 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 Query: 5 YFNNYSLSQPRHFCRACRRYWTRGGALRNVPVGG 106 YFNN SQPR+ C+ C R WT GG LRN+PV G Sbjct: 35 YFNNNKKSQPRYKCKNCCRCWTHGGVLRNIPVTG 68
>MUTA_STRCM (Q05064) Methylmalonyl-CoA mutase small subunit (EC 5.4.99.2)| (MCM-beta) Length = 616 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 47 RACRRYWTRGGALRNVPVGGGYRRHA 124 RA RR W R + VP G R+HA Sbjct: 284 RAARRLWARVAEVSGVPAAGAQRQHA 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,358,495 Number of Sequences: 219361 Number of extensions: 323773 Number of successful extensions: 929 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)