| Clone Name | bast69c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DENR_CAEEL (Q9NAH4) Density-regulated protein homolog | 29 | 5.4 | 2 | HCN2_MOUSE (O88703) Potassium/sodium hyperpolarization-activated... | 28 | 9.2 |
|---|
>DENR_CAEEL (Q9NAH4) Density-regulated protein homolog| Length = 192 Score = 28.9 bits (63), Expect = 5.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 272 DTQGAVVLAVVQGPIRGVQCPLRSRFAGLCT 364 D + AV+ ++ GPI GV PL+ + G C+ Sbjct: 3 DGETAVIQSLAPGPIDGVSYPLKMVYCGQCS 33
>HCN2_MOUSE (O88703) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 2 (Brain cyclic nucleotide gated channel 2) (BCNG-2) (Hyperpolarization-activated cation channel 1) (HAC-1) Length = 863 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 324 TPRMGPCTTARTTAP 280 TPR+GP TART AP Sbjct: 819 TPRLGPAPTARTAAP 833 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,727,692 Number of Sequences: 219361 Number of extensions: 481963 Number of successful extensions: 1406 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)