| Clone Name | bast69a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 pre... | 40 | 0.004 | 2 | FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 p... | 37 | 0.025 | 3 | FLA7_ARATH (Q9SJ81) Fasciclin-like arabinogalactan protein 7 pre... | 37 | 0.025 | 4 | FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 pre... | 34 | 0.21 | 5 | KCNAE_DROME (Q02280) Potassium voltage-gated channel protein eag... | 29 | 6.8 |
|---|
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 39.7 bits (91), Expect = 0.004 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 38 STSNSAVNVSTGIVHTTVGTALRATRPLAVYSVDKVLLPMDLFG-PKPPASAP 193 STS V + TG+ + + + P+ +++VD VLLP +LFG K P+ AP Sbjct: 290 STSGDEVILHTGVAPSRLADTVLDATPVVIFTVDNVLLPAELFGKSKSPSPAP 342
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +2 Query: 38 STSNSAVNVSTGIVHTTVGTALRATRPLAVYSVDKVLLPMDLFG-PKPPASAP 193 STS V + TG+ + + + P+ +++VD VLLP +LFG PA AP Sbjct: 291 STSGDEVILHTGVGPSRLADTVVDETPVVIFTVDNVLLPAELFGKSSSPAPAP 343
>FLA7_ARATH (Q9SJ81) Fasciclin-like arabinogalactan protein 7 precursor| Length = 254 Score = 37.0 bits (84), Expect = 0.025 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +2 Query: 47 NSAVNVSTGIVHTTVGTALRATRPLAVYSVDKVLLPMDLFG---PKPPASAP 193 + V + + T V +++ +T P+AVY V++VLLP +FG P PA AP Sbjct: 153 SGTVRIDSLWTRTKVSSSVFSTDPVAVYQVNRVLLPEAIFGTDVPPMPAPAP 204
>FLA1_ARATH (Q9FM65) Fasciclin-like arabinogalactan protein 1 precursor| Length = 424 Score = 33.9 bits (76), Expect = 0.21 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +2 Query: 56 VNVSTGIVHTTVGTALRATRPLAVYSVDKVLLPMDLF---GPKPPASAP 193 V + T I + L +PLA+Y+ DKVLLP +LF + PA AP Sbjct: 293 VTLKTRINTVKIVDTLIDEQPLAIYATDKVLLPKELFKASAVEAPAPAP 341
>KCNAE_DROME (Q02280) Potassium voltage-gated channel protein eag (Ether-a-go-go| protein) Length = 1174 Score = 28.9 bits (63), Expect = 6.8 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = -1 Query: 198 ASGADAGGLGPKRSMGSSTLSTE*TA------SGLVARSAVPTVVCTMPVETLTAL 49 A GA +GG P S G +T E A G A PT T PV+T+ + Sbjct: 930 APGAGSGGNAPDNSSGQTTPGDEICAGCGAGGGGTPTTQAPPTSAVTSPVDTVITI 985 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,209,234 Number of Sequences: 219361 Number of extensions: 411551 Number of successful extensions: 1203 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1203 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)