| Clone Name | bast65e08 |
|---|---|
| Clone Library Name | barley_pub |
>TMPS6_HUMAN (Q8IU80) Transmembrane protease, serine 6 (EC 3.4.21.-)| (Matriptase-2) Length = 802 Score = 30.4 bits (67), Expect = 2.4 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = +1 Query: 184 RSCAEQRTTPTPGGDEVPELCEGRAEEVRECGSPGPHALLPRRALAHQGKVLPNREYARC 363 RSC ++ P P D P+ +G EE +CG GP + + A++ +G+ Sbjct: 532 RSCVKK---PNPQCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVR 588 Query: 364 GDHQSGGS 387 G H GG+ Sbjct: 589 GRHICGGA 596
>BCAR3_MOUSE (Q9QZK2) Breast cancer anti-estrogen resistance protein 3| (p130Cas-binding protein AND-34) Length = 820 Score = 30.0 bits (66), Expect = 3.2 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 4/74 (5%) Frame = +1 Query: 163 SRIARLWRSCAEQRTTPTPGGDEVPELCEGRAEEVRECGSPGPHALLPRRALAHQGKVLP 342 +R LW C E+R +PG L EGR + V+ ++ R +G +L Sbjct: 248 NRTVPLW--CLEERYGTSPGRGREGSLAEGRPDVVKRLSLTTGSSIQAREHSLPRGNLLR 305 Query: 343 NREYA----RCGDH 372 N+E + C DH Sbjct: 306 NKEKSGSQPACLDH 319
>BAI3_MOUSE (Q80ZF8) Brain-specific angiogenesis inhibitor 3 precursor| Length = 1522 Score = 29.3 bits (64), Expect = 5.4 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +1 Query: 181 WRSCA-------EQRTTPTPGGDEVPELCEGRAEEVRECGS---PGPHALLP 306 W C+ E+R G + CEG EEVR C P P+ + P Sbjct: 464 WSGCSKSCDGGWERRMRTCQGAAVTGQQCEGTGEEVRRCSEQRCPAPYEICP 515
>LTBP2_MOUSE (O08999) Latent transforming growth factor beta-binding protein 2| precursor (LTBP-2) Length = 1813 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 142 TRQLLSSSRIARLWRSCAEQRTTPTPGGDEVPELC 246 T+Q+ SR+ + W S EQ P PG + E+C Sbjct: 679 TKQICCCSRVGKAWGSTCEQ--CPLPGTEAFREIC 711
>LIRB2_HUMAN (Q8N423) Leukocyte immunoglobulin-like receptor subfamily B member| 2 precursor (Leukocyte immunoglobulin-like receptor 2) (LIR-2) (Immunoglobulin-like transcript 4) (ILT-4) (Monocyte/macrophage immunoglobulin-like receptor 10) (MIR-10) (CD85d Length = 598 Score = 28.9 bits (63), Expect = 7.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 241 LCEGRAEEVRECGSPGPHALLPRRALAHQGKVLPNREYA-RC 363 LC+ +E +C + PHA RA+ G V PNR ++ RC Sbjct: 155 LCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRC 196
>BAI3_HUMAN (O60242) Brain-specific angiogenesis inhibitor 3 precursor| Length = 1522 Score = 28.5 bits (62), Expect = 9.2 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 10/52 (19%) Frame = +1 Query: 181 WRSCA-------EQRTTPTPGGDEVPELCEGRAEEVRECGS---PGPHALLP 306 W C+ E+R G + CEG EEVR C P P+ + P Sbjct: 464 WSGCSKSCDGGWERRIRTCQGAVITGQQCEGTGEEVRRCSEQRCPAPYEICP 515 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,991,357 Number of Sequences: 219361 Number of extensions: 811908 Number of successful extensions: 2928 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2928 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)