| Clone Name | bast65c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I | 31 | 1.9 | 2 | HXA5_MOUSE (P09021) Homeobox protein Hox-A5 (Hox-1.3) (M2) | 29 | 5.6 | 3 | MLOH1_ORYSA (O49914) MLO protein homolog 1 | 29 | 7.3 |
|---|
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 30.8 bits (68), Expect = 1.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 11 VDLSDESAFAVRWAVQNYLRPGDAVVLLHV 100 +DLS ES A WAV LR GD ++++ V Sbjct: 437 LDLSSESLHAAEWAVGILLRNGDTLIIVDV 466
>HXA5_MOUSE (P09021) Homeobox protein Hox-A5 (Hox-1.3) (M2)| Length = 270 Score = 29.3 bits (64), Expect = 5.6 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 481 TQ*CTSNHYTPEPPLPALARGPKSAASHDHGGQ 383 +Q TS H P PLP A P + HGG+ Sbjct: 87 SQPATSTHSPPPDPLPCSAVAPSPGSDSHHGGK 119
>MLOH1_ORYSA (O49914) MLO protein homolog 1| Length = 540 Score = 28.9 bits (63), Expect = 7.3 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 224 LQKKREEDFDAFTSTKSQDLAQPLVAAQIPFKIHVVKDH 340 ++KK+ D DAF + S D A P +++ +H+++DH Sbjct: 440 MEKKKVRDADAFLAQMSVDFATP-ASSRSASPVHLLQDH 477 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,816,914 Number of Sequences: 219361 Number of extensions: 597476 Number of successful extensions: 2733 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2732 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)