| Clone Name | bast65a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURD_MYCPA (Q73YQ6) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 29 | 4.8 | 2 | ERG1_ASHGO (Q75F69) Squalene monooxygenase (EC 1.14.99.7) (Squal... | 29 | 4.8 | 3 | DLGP4_HUMAN (Q9Y2H0) Disks large-associated protein 4 (DAP-4) (S... | 28 | 8.2 | 4 | DLGP4_RAT (P97839) Disks large-associated protein 4 (DAP-4) (SAP... | 28 | 8.2 |
|---|
>MURD_MYCPA (Q73YQ6) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 489 Score = 29.3 bits (64), Expect = 4.8 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +3 Query: 324 AAPGDGELRAALGASFPSLRFEIYPFRAEAVAGLISASVR 443 A PGD L A GASF +F Y R EA A + A++R Sbjct: 452 AKPGDTVLLAPAGASFD--QFAGYADRGEAFAAAVRAAIR 489
>ERG1_ASHGO (Q75F69) Squalene monooxygenase (EC 1.14.99.7) (Squalene epoxidase)| (SE) Length = 497 Score = 29.3 bits (64), Expect = 4.8 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 95 EEEEQRHGCPGHPHGRFLDSCGALC 21 EE+E+ HG G HGRFL + A+C Sbjct: 139 EEDEREHGV-GFVHGRFLQNLRAIC 162
>DLGP4_HUMAN (Q9Y2H0) Disks large-associated protein 4 (DAP-4)| (SAP90/PSD-95-associated protein 4) (SAPAP4) (PSD-95/SAP90-binding protein 4) Length = 989 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 270 SLLRHASCPESLFYHFLAAAPGDGELRAAL 359 SLL+ SC + L YH+L G GE L Sbjct: 316 SLLKSKSCHQGLAYHYLQVPGGGGEWSTTL 345
>DLGP4_RAT (P97839) Disks large-associated protein 4 (DAP-4)| (SAP90/PSD-95-associated protein 4) (SAPAP4) (PSD-95/SAP90-binding protein 4) Length = 992 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 270 SLLRHASCPESLFYHFLAAAPGDGELRAAL 359 SLL+ SC + L YH+L G GE L Sbjct: 315 SLLKSKSCHQGLAYHYLQVPGGGGEWSTTL 344 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,641,085 Number of Sequences: 219361 Number of extensions: 555897 Number of successful extensions: 2028 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2028 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)