| Clone Name | bast65a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN692_HUMAN (Q9BU19) Zinc finger protein 692 | 30 | 2.4 | 2 | ADRB1_MACMU (P47899) Beta-1 adrenergic receptor (Beta-1 adrenoce... | 29 | 3.1 | 3 | KTNA1_ARATH (Q9SEX2) Katanin p60 ATPase-containing subunit (EC 3... | 29 | 4.1 |
|---|
>ZN692_HUMAN (Q9BU19) Zinc finger protein 692| Length = 519 Score = 29.6 bits (65), Expect = 2.4 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = +2 Query: 5 HPAPL--PTQT-CGEVQPCASFSHGGPLDSSAGWRRSSRTAA 121 HPA L P ++ G ++PC S S GPL SS G R S+ A Sbjct: 471 HPALLLAPQESPSGPLEPCPSISAPGPLGSSEGSRPSASPQA 512
>ADRB1_MACMU (P47899) Beta-1 adrenergic receptor (Beta-1 adrenoceptor) (Beta-1| adrenoreceptor) Length = 480 Score = 29.3 bits (64), Expect = 3.1 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 2 PHPAPLPTQTCGEVQPCASFSHGGPL-DSSAGWRRSSRTAAGRRPR 136 P P+P+P G +P A+ + PL + AG RR SR A R + Sbjct: 279 PSPSPVPAPPPGPPRPAAAAATTAPLVNGRAGKRRPSRLVALREQK 324
>KTNA1_ARATH (Q9SEX2) Katanin p60 ATPase-containing subunit (EC 3.6.4.3)| (Katanin p60 subunit) (p60 katanin) (Atp60) (CAD ATPase) (Katanin 1) (BOTERO1 protein) (ECTOPIC ROOT HAIR 3 protein) (FAT ROOT protein) (FRAGILE FIBER 2 protein) (AtAAA1) Length = 523 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +2 Query: 14 PLPTQTCGEVQPCASF---SHGGPLDSSAGWRRSSRTAAGRRP 133 P+ T++ QP + S GGP+D WR +R RRP Sbjct: 94 PINTKSSFVFQPLDEYPTSSGGGPMDDPDVWRPPTRDVTSRRP 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,374,521 Number of Sequences: 219361 Number of extensions: 245937 Number of successful extensions: 929 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 929 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)