ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast64f11 |
|---|---|
| Clone Library Name | barley_pub |
>ILR1_ARATH (P54968) IAA-amino acid hydrolase ILR1 precursor (EC 3.5.1.-)| Length = 442 Score = 57.4 bits (137), Expect = 1e-08 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 W+RG+RR+IH+ PE FQE +TS+LVR ELD++GV Y Sbjct: 51 WMRGIRRKIHENPETGFQEFKTSQLVRDELDSLGVKY 87
>ILL3_ARATH (O81641) IAA-amino acid hydrolase ILR1-like 3 precursor (EC| 3.5.1.-) Length = 428 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 WL VRR+IH+ PEL F+ H+TS L+RRELD +GV Y Sbjct: 40 WLVSVRRQIHENPELLFELHKTSALIRRELDELGVSY 76
>ILL6_ARATH (Q8VYX0) IAA-amino acid hydrolase ILR1-like 6 precursor (EC| 3.5.1.-) (Protein gr1) Length = 464 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 WL+ VRR IH+ PELAF+E+ TS L+R ELD +G+ Y Sbjct: 88 WLKRVRRTIHENPELAFEEYETSRLIRSELDRMGIMY 124
>ILL5_ARATH (Q9SWX9) IAA-amino acid hydrolase ILR1-like 5 precursor (EC| 3.5.1.-) Length = 435 Score = 51.2 bits (121), Expect = 7e-07 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 W+ G+RRRIH+ PEL ++E TS+LV+ ELD +GV Y Sbjct: 47 WMVGIRRRIHENPELGYEEVETSKLVKTELDKMGVSY 83
>ILL4_ARATH (O04373) IAA-amino acid hydrolase ILR1-like 4 precursor (EC| 3.5.1.-) Length = 440 Score = 50.8 bits (120), Expect = 9e-07 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 W+ G+RRRIH+ PEL ++E TS+LVR EL+ +GV Y Sbjct: 47 WMVGIRRRIHENPELGYEEVETSKLVRAELEKMGVSY 83
>ILL2_ARATH (P54970) IAA-amino acid hydrolase ILR1-like 2 precursor (EC| 3.5.1.-) Length = 439 Score = 47.0 bits (110), Expect = 1e-05 Identities = 18/37 (48%), Positives = 28/37 (75%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 W+ +RR+IH+ PEL ++E TS+L+R EL+ IG+ Y Sbjct: 50 WMVKIRRKIHENPELGYEELETSKLIRSELELIGIKY 86
>ILL1_ARATH (P54969) IAA-amino acid hydrolase ILR1-like 1 precursor (EC| 3.5.1.-) Length = 438 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/33 (54%), Positives = 25/33 (75%) Frame = +2 Query: 128 VRRRIHQRPELAFQEHRTSELVRRELDAIGVPY 226 +RR+IH+ PEL ++E TS+ +R ELD IGV Y Sbjct: 53 IRRKIHENPELGYEEFETSKFIRSELDLIGVKY 85
>CBPX2_SULSO (P58156) Thermostable carboxypeptidase 2 (EC 3.4.17.-)| Length = 393 Score = 40.0 bits (92), Expect = 0.002 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGV 220 W+ +RR+IH+ PEL+++E+ TS+LV L +G+ Sbjct: 17 WIIQIRRKIHENPELSYKEYSTSKLVAETLRKLGI 51
>CBPX1_SULSO (P80092) Thermostable carboxypeptidase 1 (EC 3.4.17.-)| Length = 393 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = +2 Query: 116 WLRGVRRRIHQRPELAFQEHRTSELVRRELDAIGV 220 W+ +RR+IH+ PEL+++E+ TS+LV L +GV Sbjct: 17 WIIQIRRKIHEYPELSYKEYNTSKLVAETLRKLGV 51
>AMAA_BACST (P37112) N-acyl-L-amino acid amidohydrolase (EC 3.5.1.14)| (L-aminoacylase) Length = 370 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 131 RRRIHQRPELAFQEHRTSELVRRELDAIG 217 RR +H PEL+FQE +T++ V L + G Sbjct: 21 RRHLHAHPELSFQEEKTAQFVYETLQSFG 49
>YXEP_BACSU (P54955) Hypothetical protein yxeP| Length = 380 Score = 32.7 bits (73), Expect = 0.26 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 119 LRGVRRRIHQRPELAFQEHRTSELVRRELD 208 L +RR +H+ PEL+FQE T++ +RR L+ Sbjct: 10 LINMRRDLHEHPELSFQEVETTKKIRRWLE 39
>YTNL_BACSU (O34980) Hypothetical protein ytnL| Length = 416 Score = 31.2 bits (69), Expect = 0.76 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 119 LRGVRRRIHQRPELAFQEHRTSELVRRELDAIGV 220 L G+RR +HQ PEL+ +E T+ +++ L G+ Sbjct: 41 LIGIRRHLHQYPELSKEEFETTAFIKKCLKEKGI 74
>HIPO_CAMJE (P45493) Hippurate hydrolase (EC 3.5.1.32) (Benzoylglycine| amidohydrolase) (Hippuricase) Length = 383 Score = 30.8 bits (68), Expect = 0.99 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 128 VRRRIHQRPELAFQEHRTSELVRRELDAIG 217 +R +IH+ PEL F E T++LV ++L G Sbjct: 17 IRHQIHENPELGFDELCTAKLVAQKLKEFG 46
>Y100_SYNY3 (P54984) Hypothetical protein sll0100| Length = 393 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 128 VRRRIHQRPELAFQEHRTSELVRRELDAIGV 220 +RR +H PEL+ QE++T+ V L + G+ Sbjct: 17 IRRHLHAHPELSGQEYQTAAYVAGVLSSCGL 47
>SYR_CAUCR (Q9A347) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 600 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -3 Query: 205 ELAADELAGAVLLEGQLRALVD-APPHAAQP 116 E+A+D+ GA LLE R L+D A P+ A+P Sbjct: 98 EIASDDRTGAQLLETPRRVLIDYAGPNVAKP 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,424,948 Number of Sequences: 219361 Number of extensions: 130175 Number of successful extensions: 505 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
